The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.2133: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: NAD-dependent protein deacetylase of SIR2 family
Translate Function Assignments



Context on contig NC_002951 from base 2263934 to 2276649 (12716 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2126 2265295 2263934 1362 -           PTS system, lactose-specific IIB component (EC 2.7.1.69) / PTS system, lactose-specific IIC component (EC 2.7.1.69) gene_name|lacE, locus|SACOL2181, protein_id|YP_186992.1, gi|57650777, geneID|3238567
2127 2265963 2265652 312 - 356       dlit(4096897)
dlit(7306504)
dlit(2824493)
dlit(1881873)
dlit(7138836)
PTS system, lactose-specific IIA component (EC 2.7.1.207) gene_name|lacF, locus|SACOL2182, protein_id|YP_186993.1, gi|57650778, geneID|3238568
2128 2266965 2265985 981 - 21       dlit(2543958)
dlit(1655695)
Tagatose 1,6-bisphosphate aldolase (EC 4.1.2.40) gene_name|lacD, locus|SACOL2183, protein_id|YP_186994.1, gi|57650779, geneID|3238060
2129 2267901 2266969 933 - 3         Tagatose-6-phosphate kinase (EC 2.7.1.144) gene_name|lacC, locus|SACOL2184, protein_id|YP_186995.1, gi|57650780, geneID|3238197
2130 2268429 2267914 516 - 12         Galactose-6-phosphate isomerase, LacB subunit (EC 5.3.1.26) gene_name|lacB, locus|SACOL2185, protein_id|YP_186996.1, gi|57650781, geneID|3238198
2131 2268873 2268445 429 - 15       dlit(2163387) Galactose-6-phosphate isomerase, LacA subunit (EC 5.3.1.26) locus|SACOL2186, protein_id|YP_186997.1, gi|57650782, geneID|3238604
2132 2269996 2269241 756 - 367         Lactose phosphotransferase system repressor gene_name|lacR, locus|SACOL2188, protein_id|YP_186999.1, gi|57650784, geneID|3238563
2133 2270247 2270978 732 + 250     5: 1 2 3 4 5   NAD-dependent protein deacetylase of SIR2 family locus|SACOL2189, protein_id|YP_187000.1, gi|57650785, geneID|3238564
2134 2271015 2271176 162 + 36         FIG01107911: hypothetical protein  
2135 2271877 2271269 609 - 92         FIG01108842: hypothetical protein locus|SACOL2190, protein_id|YP_187001.1, gi|57650786, geneID|3238090
2136 2272264 2272139 126 - 261         Doubtful CDS. No database matches locus|SACOL2191, protein_id|YP_187002.1, gi|57650787, geneID|3238091
2137 2273332 2272484 849 - 219         Oxidoreductase of aldo/keto reductase family, subgroup 1 locus|SACOL2192, protein_id|YP_187003.1, gi|57650788, geneID|3238569
2138 2273818 2273402 417 - 69         Transcriptional regulator, MerR family locus|SACOL2193, protein_id|YP_187004.1, gi|57650789, geneID|3238570
2139 2274226 2276649 2424 + 407         Hyaluronate lyase precursor (EC 4.2.2.1) gene_name|hysA, locus|SACOL2194, protein_id|YP_187005.1, gi|57650790, geneID|3238658

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Redox-dependent_regulation_of_nucleus_processes OlgaV NAD-dependent protein deacetylase of SIR2 family
Pyruvate_metabolism_II:_acetyl-CoA,_acetogenesis_from_pyruvate SvetaG NAD-dependent protein deacetylase of SIR2 family
sirtuins nguyen_hong_user NAD-dependent protein deacetylase of SIR2 family
Cobalamin_(Wirth) Wirth_Joe_user NAD-dependent protein deacetylase of SIR2 family
NAD_and_NADP_cofactor_biosynthesis_global AndreiO *NAD-dependent protein deacetylase of SIR2 family


  Protein Sequence

>fig|93062.19.peg.2133 NAD-dependent protein deacetylase of SIR2 family
MKHDLETLKHIIDSSNRITFFTGAGVSVASGVPDFRSMGGLFDEISKDGLSPEYLLSRDY
LEDDPEGFINFCHKRLLFVDTMPNIVHDWIAKLERNQQSLGIITQNIDGLHSDAGSQHVD
ELHGTLNRFYCNVCHKSYTKSDVIDRTLKHCDNCGGAIRPDIVLYGEMLDQPTIIRALNK
IEHADTLVVLGSSLVVQPAAGLISHFKGDNLIIINKDRTPYDSDATLVIHDDMVSVVKSL
MTE

MD5 = 9dc2aca2485b44077cd840e1682686a4


  DNA Sequence

>fig|93062.19.peg.2133 NAD-dependent protein deacetylase of SIR2 family
ttgaaacatgatttagagacactaaaacatattatagatagttcgaatcgtattacattt
tttacaggtgctggtgtatctgtcgcaagtggcgttccagatttccgttcaatgggtggc
ttatttgatgaaatttcaaaagatgggctttcgccagaatacttgttaagccgtgattat
ttagaagatgatcctgaaggttttatcaatttctgccataagcgcttactatttgtcgat
acgatgcccaatatcgttcatgattggattgcaaaattagaacgtaatcaacaatcttta
ggtatcatcacgcaaaatatcgatggtttgcactcagacgctggaagtcaacatgttgat
gaattacatggcacgttaaatcgtttttattgtaatgtatgtcataaatcttatacgaag
tcagatgttattgatagaactttgaaacattgtgataattgtggtggtgccattcgaccg
gacatcgtattatacggtgaaatgttagatcaacctaccatcataagggcattaaataaa
attgaacatgctgacacccttgttgtactaggttcatcactcgttgtacaacctgccgca
ggattaatatcacattttaaaggcgacaatttaattattatcaataaagatcgaacacct
tatgatagcgacgctactttggtcatacatgacgacatggtttccgttgtaaaatcatta
atgacagagtaa


  DNA with Flanking Sequence

>fig|93062.19.peg.2133 NAD-dependent protein deacetylase of SIR2 family
ctataaatcgtttttctgcaatttgacgggtatgtttttctttatgcgatatttctttat
actgaaatgttgaattactgcgtgcaccaccatgaatcttcgttaaaatccctttatttt
ccaattcaattaaatctcttcgaactgtcatatcagacacatttaaaccttcgacgattt
cattcgttcttatcgtgccctttttattcactagtttagcaatttcgtccaaacgttcat
gtttattcaatgtaaaattgcctcctttatttaggcgatgggtcattatcctttatgttt
agacatcaattttaatatacatgcttattctataataaaaattgcgtaaaaactaatata
atttaactgttcgattatatgtataattcatttttaaaaagaactgtttaaactgcgctt
ttgataatcgtaaaatgaatatactataataaaagtaaaagacgttataaatcattcatt
attttgatggggtgtttaacttgaaacatgatttagagacactaaaacatattatagata
gttcgaatcgtattacattttttacaggtgctggtgtatctgtcgcaagtggcgttccag
atttccgttcaatgggtggcttatttgatgaaatttcaaaagatgggctttcgccagaat
acttgttaagccgtgattatttagaagatgatcctgaaggttttatcaatttctgccata
agcgcttactatttgtcgatacgatgcccaatatcgttcatgattggattgcaaaattag
aacgtaatcaacaatctttaggtatcatcacgcaaaatatcgatggtttgcactcagacg
ctggaagtcaacatgttgatgaattacatggcacgttaaatcgtttttattgtaatgtat
gtcataaatcttatacgaagtcagatgttattgatagaactttgaaacattgtgataatt
gtggtggtgccattcgaccggacatcgtattatacggtgaaatgttagatcaacctacca
tcataagggcattaaataaaattgaacatgctgacacccttgttgtactaggttcatcac
tcgttgtacaacctgccgcaggattaatatcacattttaaaggcgacaatttaattatta
tcaataaagatcgaacaccttatgatagcgacgctactttggtcatacatgacgacatgg
tttccgttgtaaaatcattaatgacagagtaatcagtatgtaaaaagcatttcccgaatg
gtagggaaatgcttttaattttggagttgcgtttttggaatttggagtttggttttcgga
attcgacatttggaattcagaattataatgagtggaaaattttaattattgcgtgtttaa
tgacttggttttgtagcgatttttatttgatgaattgtttttttgtttgatgttgggatg
ctacttttaatggtttgtcatttgtaagattaaaaataaacataaaataagtagaaaaat
aaaagctacgaatattaaaaaattagatatcttcattatcaaattccgatattaaatcat
tatatttttcagaatatcttgcataatcttcattattattaaaagctagccatagacctc
tatcatcatataaatgatatattaagtttttagtattgttaattatatatatttcagaat
aattatcattctgattgatatttggaactaaccctttaaagtcttgattgga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005737       C:cytoplasm
GO:0006342       P:chromatin silencing
GO:0006476       P:protein amino acid deacetylation
GO:0008270       F:zinc ion binding
GO:0016811       F:hydrolase activity, acting on carbon-nitrog...
GO:0070403       F:NAD binding
cmr|SACOL2189 Staphylococcus aureus subsp. aureus COL     transcriptional regulator, Sir2 family
fig|93062.4.peg.2217 Staphylococcus aureus subsp. aureus COL FIG   NAD-dependent protein deacetylase of SIR2 family
gb|AAW37065.1 Staphylococcus aureus subsp. aureus COL     transcriptional regulator, Sir2 family
gi|57284971 Staphylococcus aureus subsp. aureus COL NCBI   transcriptional regulator, Sir2 family
gi|57650785 Staphylococcus aureus subsp. aureus COL NCBI   NAD-dependent deacetylase
gi|76363270 organism not parsed/found in ncbi nr NCBI   RecName: Full=NAD-dependent deacetylase; AltName: Full=Regulatory protein SIR2 homolog
img|637152953 Staphylococcus aureus aureus COL IMG   transcriptional regulator, Sir2 family
kegg|sac:SACOL2189 Staphylococcus aureus subsp. aureus COL KEGG   NAD-dependent deacetylase
ref|YP_187000.1 Staphylococcus aureus subsp. aureus COL RefSeq   NAD-dependent deacetylase
sp|NPD_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=NAD-dependent deacetylase; AltName: Full=Regulatory protein SIR2 homolog
sp|Q5HE07 Staphylococcus aureus (strain COL) SwissProt   NAD-dependent deacetylase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search