The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.2064: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: CTP synthase (EC 6.3.4.2)
Translate Function Assignments



Context on contig NC_002951 from base 2173813 to 2186403 (12591 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2059 2175240 2173813 1428 -       5: 14 11 15 16 17   Aldehyde dehydrogenase (NAD(+)) (EC 1.2.1.3) locus|SACOL2114, protein_id|YP_186929.1, gi|57652144, geneID|3237480
2060 2175651 2175478 174 - 237         Transcriptional regulator, HxlR family locus|SACOL2115, protein_id|YP_186930.1, gi|57652145, geneID|3237466
2061 2177161 2175902 1260 - 250 6 2: 3 8   UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC 2.5.1.7) gene_name|murAB, locus|SACOL2116, protein_id|YP_186931.1, gi|57652146, geneID|3237467
2062 2178487 2177627 861 - 465 8 2: 4 7   Fructose-bisphosphate aldolase class II (EC 4.1.2.13) gene_name|fbaA, locus|SACOL2117, protein_id|YP_186932.1, gi|57652147, geneID|3237468
2063 2178705 2179226 522 + 217         Hypothetical protein MW2050 locus|SACOL2118, protein_id|YP_186933.1, gi|57652148, geneID|3237469
2064 2180945 2179335 1611 - 108   2: 6 13   CTP synthase (EC 6.3.4.2) gene_name|pyrG, locus|SACOL2119, protein_id|YP_186934.1, gi|57652149, geneID|3237470
2065 2181811 2181281 531 - 335 7 1: 10   Transcription delta factor gene_name|rpoE, locus|SACOL2120, protein_id|YP_186935.1, gi|57652150, geneID|3237471
2066 2182783 2181923 861 - 111         spermine/spermidine acetyltransferase blt locus|SACOL2121, protein_id|YP_186936.1, gi|57652151, geneID|3237472
2067 2183207 2184010 804 + 423     9: 5 2 20 1 9 18 21 12 19 dlit(15548531) Pantothenate kinase type II, eukaryotic (EC 2.7.1.33) locus|SACOL2122, protein_id|YP_186937.1, gi|57652152, geneID|3237458
2068 2184811 2184140 672 - 129         Hypothetical protein SAV2131 locus|SACOL2123, protein_id|YP_186938.1, gi|57652153, geneID|3237459
2069 2186403 2185210 1194 - 398         Hypothetical protein SAV2132 locus|SACOL2124, protein_id|YP_186939.1, gi|57652154, geneID|3237460

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
EC_6.3.4.-_Ligases_that_form_carbon-nitrogen_bonds gjo CTP synthase (EC 6.3.4.2)
pyrimidine_conversions RossO CTP synthase (EC 6.3.4.2)


  Protein Sequence

>fig|93062.19.peg.2064 CTP synthase (EC 6.3.4.2)
MTKFIFVTGGVVSSLGKGITASSLGRLLKDRGLNVTIQKFDPYLNVDPGTMSPYQHGEVF
VTDDGAETDLDLGHYERFIDINLNKFSNVTAGKVYSHVLKKERRGDYLGGTVQVIPHITN
EIKERLLLAGESTNADVVITEIGGTTGDIESLPFIEAIRQIRSDLGRENVMYVHCTLLPY
IKAAGEMKTKPTQHSVKELRGLGIQPDLIVVRTEYEMTQDLKDKIALFCDINKESVIECR
DADSLYEIPLQLSQQNMDDIVIKRLQLNAKYETQLDEWKQLLDIVNNLDGKITIGLVGKY
VSLQDAYLSVVESLKHAGYPFAKDIDIRWIDSSEVTDENAAEYLADVDGILVPGGFGFRA
SEGKISAIKYARENNVPFFGICLGMQLATVEFSRNVLGLEGAHSAELDPATPYPIIDLLP
EQKDIEDLGGTLRLGLYPCSIKEGTLAQDVYGKAEIEERHRHRYEFNNDYREQLEANGMV
ISGTSPDGRLVEMVEIPTNDFFIACQFHPEFLSRPNRPHPIFKSFIEASLKYQQNK

MD5 = 4ce5c1350842ab8ddf2480712619a0f3


  DNA Sequence

>fig|93062.19.peg.2064 CTP synthase (EC 6.3.4.2)
atgacaaaatttatttttgtaacaggtggcgtagtttcatcattagggaagggtattaca
gcatcttctctaggtagattattaaaagatagaggtctaaatgtaacaattcaaaaattc
gatccatacttaaatgttgacccaggtacaatgagtccttatcaacatggtgaagtattc
gtaacggatgatggtgcagaaactgacctagacttaggacattacgaaagatttattgat
attaatttaaacaagttttcaaatgtgacagccggtaaagtgtattcacacgtattgaaa
aaagaacgtcgtggtgattacttaggcggaacagttcaagttattccgcatattacaaat
gaaattaaagaacgtttattacttgcaggggaaagtacgaatgcagacgttgttatcact
gaaattggcggtacaacaggtgatattgagtcattaccgtttattgaagcgattcgtcaa
attcgtagcgatttaggtagagaaaatgttatgtatgttcactgtacattactgccttat
attaaagctgctggagaaatgaaaacgaagccaacacaacatagtgttaaagaattacga
ggcttaggtattcaaccagacttaatcgttgtaagaactgaatatgaaatgacacaagat
ttaaaagataaaattgcattattctgtgacattaataaagaaagtgttattgaatgtcgt
gatgcagactctttatacgaaattccattacaattaagccaacaaaatatggatgatatc
gttattaaacgtttacaattaaacgcgaaatatgaaacacagcttgatgaatggaaacag
ttgttagatatcgttaataatttagatggtaaaattacaattggtttagtaggtaaatat
gttagcttacaagatgcatatttatcagttgttgaatcattgaaacatgctggatatcct
tttgccaaagatattgacattagatggattgattcaagtgaagtaacagatgaaaatgca
gccgaataccttgcagatgtcgacggtattttagtaccaggtggatttggtttccgtgca
agtgaaggtaaaattagtgcaattaagtatgctagagaaaacaatgtaccattctttggt
atttgtttaggaatgcaacttgcaacagttgaattttcaagaaacgtattaggccttgaa
ggcgcacattcagctgaattagacccagcaacaccatacccaattatagatttattacca
gaacaaaaagatatcgaagatttaggtggtacattacgcttaggcttatatccatgttca
attaaagaaggcacattggcacaagatgtttatggtaaagcggaaattgaagaaagacat
cgtcatcgttatgaatttaataatgactatagagaacaattagaagcaaatggtatggtg
atttctggtacaagtccagatggacgtttagtagaaatggtagagattccgacaaatgat
ttctttattgcttgtcaattccacccagaattcttatctagaccaaatcgtccgcacccg
atttttaaatcatttattgaagcttcattaaaatatcaacaaaataaataa


  DNA with Flanking Sequence

>fig|93062.19.peg.2064 CTP synthase (EC 6.3.4.2)
gatgatattccagctcaaacagatgatcaagaagaactaaatgatccagaagatgagcag
gttgaagaagaaatcaatcattcggatatagtcattgaagaagatgaagatgaactagac
gaagacgaagaagtgtttgaagacgaagaagacttcaacgattaattttttgtttgactt
ttagttgaaagatgataaaattttattcgggctcctttaaataggacacgtgtataaaat
ttatacgctccccttacagaatttgtgagagggagcgtttttttatttaattgagtaaat
caagaaatgataacgcaaaaatcaaagttgtaaatgatatacatagtgacatagcagtat
ggaaacggtaagtaaacagaatttaattttgtcgaattcgacaaataaacaacttgaatg
agcttgctttaatgttatgttttacgtaatttttacaattgatgaggaagcattcccttt
aataattaggaggtcaagacatgacaaaatttatttttgtaacaggtggcgtagtttcat
cattagggaagggtattacagcatcttctctaggtagattattaaaagatagaggtctaa
atgtaacaattcaaaaattcgatccatacttaaatgttgacccaggtacaatgagtcctt
atcaacatggtgaagtattcgtaacggatgatggtgcagaaactgacctagacttaggac
attacgaaagatttattgatattaatttaaacaagttttcaaatgtgacagccggtaaag
tgtattcacacgtattgaaaaaagaacgtcgtggtgattacttaggcggaacagttcaag
ttattccgcatattacaaatgaaattaaagaacgtttattacttgcaggggaaagtacga
atgcagacgttgttatcactgaaattggcggtacaacaggtgatattgagtcattaccgt
ttattgaagcgattcgtcaaattcgtagcgatttaggtagagaaaatgttatgtatgttc
actgtacattactgccttatattaaagctgctggagaaatgaaaacgaagccaacacaac
atagtgttaaagaattacgaggcttaggtattcaaccagacttaatcgttgtaagaactg
aatatgaaatgacacaagatttaaaagataaaattgcattattctgtgacattaataaag
aaagtgttattgaatgtcgtgatgcagactctttatacgaaattccattacaattaagcc
aacaaaatatggatgatatcgttattaaacgtttacaattaaacgcgaaatatgaaacac
agcttgatgaatggaaacagttgttagatatcgttaataatttagatggtaaaattacaa
ttggtttagtaggtaaatatgttagcttacaagatgcatatttatcagttgttgaatcat
tgaaacatgctggatatccttttgccaaagatattgacattagatggattgattcaagtg
aagtaacagatgaaaatgcagccgaataccttgcagatgtcgacggtattttagtaccag
gtggatttggtttccgtgcaagtgaaggtaaaattagtgcaattaagtatgctagagaaa
acaatgtaccattctttggtatttgtttaggaatgcaacttgcaacagttgaattttcaa
gaaacgtattaggccttgaaggcgcacattcagctgaattagacccagcaacaccatacc
caattatagatttattaccagaacaaaaagatatcgaagatttaggtggtacattacgct
taggcttatatccatgttcaattaaagaaggcacattggcacaagatgtttatggtaaag
cggaaattgaagaaagacatcgtcatcgttatgaatttaataatgactatagagaacaat
tagaagcaaatggtatggtgatttctggtacaagtccagatggacgtttagtagaaatgg
tagagattccgacaaatgatttctttattgcttgtcaattccacccagaattcttatcta
gaccaaatcgtccgcacccgatttttaaatcatttattgaagcttcattaaaatatcaac
aaaataaataaatttgctaataaaaccggtactttcattgttaaacattgaaagtaccgg
tttttcgtataattttaatattatgttagtgacaaggtatgaaataacaatagtgacttt
tataattctaagtctcttgtcatttcaatcatttgtgtataaatgtcatagtatacataa
ttcaatgccatcgcatgtggttggacaatcttatcgtaatcttcagtgtagactataggt
cttggtgtagataaatcgataaaatgtacgagatgatcagggaaatcatctgttttaggt
ttgttgcttattaagaccacatcgatatctaagtcgataagtttttgaatatctaatgca
acttgatcattataaaatggtgcgaataataatacacgatcagttgagtcaatttcttta
aagtctttaatagcgtcaagttttcggctagattttaaacgctcatcactatgtagaatg
aaactttcgaaaaactgtaaatcatcataac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003883       F:CTP synthase activity
GO:0005524       F:ATP binding
GO:0006221       P:pyrimidine nucleotide biosynthetic process
GO:0006541       P:glutamine metabolic process
cmr|NT01SA2121 Staphylococcus aureus N315     CTP synthase
cmr|NT02SA2132 Staphylococcus aureus Mu50     CTP synthase
cmr|NT03SA2221 Staphylococcus aureus MW2     CTP synthase
cmr|NT08SA2181 Staphylococcus aureus subsp. aureus MRSA252     CTP synthase
cmr|NT09SA2042 Staphylococcus aureus subsp. aureus MSSA476     CTP synthase
cmr|NT11SA2019 Staphylococcus aureus RF122     CTP synthase
cmr|SACOL2119 Staphylococcus aureus subsp. aureus COL     CTP synthase
cmr|SAUSA300_2081 Staphylococcus aureus subsp. aureus USA300-FPR3757     CTP synthase
dbj|BAB43213.1 Staphylococcus aureus subsp. aureus N315     CTP synthase
dbj|BAB58289.1 Staphylococcus aureus subsp. aureus Mu50     CTP synthase
dbj|BAB95916.1 Staphylococcus aureus subsp. aureus MW2     CTP synthase
dbj|BAF68303.1 Staphylococcus aureus subsp. aureus str. Newman     CTP synthase
dbj|BAF78994.1 Staphylococcus aureus subsp. aureus Mu3     CTP synthase
emb|CAG41196.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   putative CTP synthase
emb|CAG43838.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative CTP synthase
emb|CAI81700.1 Staphylococcus aureus RF122 EMBL   CTP synthase
fig|158878.1.peg.2127 Staphylococcus aureus subsp. aureus Mu50 FIG   CTP synthase (EC 6.3.4.2)
fig|158878.14.peg.2201 Staphylococcus aureus subsp. aureus Mu50 FIG   CTP synthase (EC 6.3.4.2)
fig|158879.1.peg.1996 Staphylococcus aureus subsp. aureus N315 FIG   CTP synthase (EC 6.3.4.2)
fig|158879.11.peg.2085 Staphylococcus aureus subsp. aureus N315 FIG   CTP synthase (EC 6.3.4.2)
fig|196620.1.peg.2051 Staphylococcus aureus subsp. aureus MW2 FIG   CTP synthase (EC 6.3.4.2)
fig|196620.5.peg.2126 Staphylococcus aureus subsp. aureus MW2 FIG   CTP synthase (EC 6.3.4.2)
fig|273036.3.peg.1950 Staphylococcus aureus RF122 FIG   CTP synthase (EC 6.3.4.2)
fig|273036.6.peg.2118 Staphylococcus aureus RF122 FIG   CTP synthase (EC 6.3.4.2)
fig|282458.1.peg.2092 Staphylococcus aureus subsp. aureus MRSA252 FIG   CTP synthase (EC 6.3.4.2)
fig|282458.4.peg.2225 Staphylococcus aureus subsp. aureus MRSA252 FIG   CTP synthase (EC 6.3.4.2)
fig|282459.1.peg.2007 Staphylococcus aureus subsp. aureus MSSA476 FIG   CTP synthase (EC 6.3.4.2)
fig|282459.5.peg.2112 Staphylococcus aureus subsp. aureus MSSA476 FIG   CTP synthase (EC 6.3.4.2)
fig|359786.13.peg.2280 Staphylococcus aureus subsp. aureus JH9 FIG   CTP synthase (EC 6.3.4.2)
fig|359786.3.peg.571 Staphylococcus aureus subsp. aureus JH9 FIG   CTP synthase (EC 6.3.4.2)
fig|359787.11.peg.2248 Staphylococcus aureus subsp. aureus JH1 FIG   CTP synthase (EC 6.3.4.2)
fig|359787.3.peg.267 Staphylococcus aureus subsp. aureus JH1 FIG   CTP synthase (EC 6.3.4.2)
fig|367830.3.peg.578 Staphylococcus aureus subsp. aureus USA300 FIG   CTP synthase (EC 6.3.4.2)
fig|418127.4.peg.1960 Staphylococcus aureus subsp. aureus Mu3 FIG   CTP synthase (EC 6.3.4.2)
fig|418127.6.peg.2169 Staphylococcus aureus subsp. aureus Mu3 FIG   CTP synthase (EC 6.3.4.2)
fig|426430.6.peg.1975 Staphylococcus aureus subsp. aureus str. Newman FIG   CTP synthase (EC 6.3.4.2)
fig|426430.8.peg.2217 Staphylococcus aureus subsp. aureus str. Newman FIG   CTP synthase (EC 6.3.4.2)
fig|450394.6.peg.2587 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   CTP synthase (EC 6.3.4.2)
fig|451515.3.peg.2221 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   CTP synthase (EC 6.3.4.2)
fig|451516.9.peg.2210 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   CTP synthase (EC 6.3.4.2)
fig|452948.4.peg.1823 Staphylococcus aureus 930918-3 FIG   CTP synthase (EC 6.3.4.2)
fig|455227.3.peg.1252 Staphylococcus aureus D30 FIG   CTP synthase (EC 6.3.4.2)
fig|505321.3.peg.1306 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   CTP synthase (EC 6.3.4.2)
fig|546342.3.peg.11 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   CTP synthase (EC 6.3.4.2)
fig|546343.3.peg.1686 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   CTP synthase (EC 6.3.4.2)
fig|548470.3.peg.2211 Staphylococcus aureus subsp. aureus MN8 FIG   CTP synthase (EC 6.3.4.2)
fig|548473.3.peg.2437 Staphylococcus aureus subsp. aureus TCH60 FIG   CTP synthase (EC 6.3.4.2)
fig|548474.3.peg.1902 Staphylococcus aureus subsp. aureus TCH130 FIG   CTP synthase (EC 6.3.4.2)
fig|548475.3.peg.2585 Staphylococcus aureus subsp. aureus TCH70 FIG   CTP synthase (EC 6.3.4.2)
fig|553565.3.peg.158 Staphylococcus aureus A5937 FIG   CTP synthase (EC 6.3.4.2)
fig|553567.3.peg.2670 Staphylococcus aureus A5948 FIG   CTP synthase (EC 6.3.4.2)
fig|553568.3.peg.2453 Staphylococcus aureus A6224 FIG   CTP synthase (EC 6.3.4.2)
fig|553571.3.peg.687 Staphylococcus aureus A6300 FIG   CTP synthase (EC 6.3.4.2)
fig|553573.3.peg.11 Staphylococcus aureus A8115 FIG   CTP synthase (EC 6.3.4.2)
fig|553574.3.peg.2090 Staphylococcus aureus A8117 FIG   CTP synthase (EC 6.3.4.2)
fig|553577.3.peg.2114 Staphylococcus aureus A8796 FIG   CTP synthase (EC 6.3.4.2)
fig|553580.3.peg.2201 Staphylococcus aureus A8819 FIG   CTP synthase (EC 6.3.4.2)
fig|553581.3.peg.659 Staphylococcus aureus A9299 FIG   CTP synthase (EC 6.3.4.2)
fig|553588.3.peg.2411 Staphylococcus aureus A9719 FIG   CTP synthase (EC 6.3.4.2)
fig|553590.4.peg.2155 Staphylococcus aureus A9754 FIG   CTP synthase (EC 6.3.4.2)
fig|553592.3.peg.178 Staphylococcus aureus A9763 FIG   CTP synthase (EC 6.3.4.2)
fig|553594.3.peg.1481 Staphylococcus aureus A9765 FIG   CTP synthase (EC 6.3.4.2)
fig|553596.3.peg.753 Staphylococcus aureus A9781 FIG   CTP synthase (EC 6.3.4.2)
fig|553601.3.peg.2420 Staphylococcus aureus A10102 FIG   CTP synthase (EC 6.3.4.2)
fig|585143.3.peg.2682 Staphylococcus aureus subsp. aureus 55/2053 FIG   CTP synthase (EC 6.3.4.2)
fig|585147.3.peg.1682 Staphylococcus aureus subsp. aureus A017934/97 FIG   CTP synthase (EC 6.3.4.2)
fig|585148.3.peg.1670 Staphylococcus aureus subsp. aureus Btn1260 FIG   CTP synthase (EC 6.3.4.2)
fig|585149.6.peg.2300 Staphylococcus aureus subsp. aureus C101 FIG   CTP synthase (EC 6.3.4.2)
fig|585150.3.peg.2756 Staphylococcus aureus subsp. aureus C160 FIG   CTP synthase (EC 6.3.4.2)
fig|585151.3.peg.1842 Staphylococcus aureus subsp. aureus C427 FIG   CTP synthase (EC 6.3.4.2)
fig|585153.3.peg.2747 Staphylococcus aureus subsp. aureus E1410 FIG   CTP synthase (EC 6.3.4.2)
fig|585154.3.peg.2183 Staphylococcus aureus subsp. aureus EMRSA16 FIG   CTP synthase (EC 6.3.4.2)
fig|585156.3.peg.1679 Staphylococcus aureus subsp. aureus M1015 FIG   CTP synthase (EC 6.3.4.2)
fig|585157.3.peg.1795 Staphylococcus aureus subsp. aureus M809 FIG   CTP synthase (EC 6.3.4.2)
fig|585158.3.peg.2666 Staphylococcus aureus subsp. aureus M876 FIG   CTP synthase (EC 6.3.4.2)
fig|585159.3.peg.2227 Staphylococcus aureus subsp. aureus M899 FIG   CTP synthase (EC 6.3.4.2)
fig|585160.3.peg.1614 Staphylococcus aureus subsp. aureus WBG10049 FIG   CTP synthase (EC 6.3.4.2)
fig|585161.3.peg.1956 Staphylococcus aureus subsp. aureus WW2703/97 FIG   CTP synthase (EC 6.3.4.2)
fig|585891.3.peg.2198 Staphylococcus aureus subsp. aureus Mu50-omega FIG   CTP synthase (EC 6.3.4.2)
fig|644279.4.peg.2269 Staphylococcus aureus subsp. aureus 132 FIG   CTP synthase (EC 6.3.4.2)
fig|680649.3.peg.727 Staphylococcus aureus subsp. aureus MR1 FIG   CTP synthase (EC 6.3.4.2)
fig|681288.4.peg.2146 Staphylococcus aureus subsp. aureus ED98 FIG   CTP synthase (EC 6.3.4.2)
fig|703339.3.peg.2107 Staphylococcus aureus 04-02981 FIG   CTP synthase (EC 6.3.4.2)
fig|762962.3.peg.2380 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   CTP synthase (EC 6.3.4.2)
fig|93062.4.peg.2125 Staphylococcus aureus subsp. aureus COL FIG   CTP synthase (EC 6.3.4.2)
gb|AAW38429.1 Staphylococcus aureus subsp. aureus COL     CTP synthase
gb|ABD21041.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     CTP synthase
gb|ABQ49945.1 Staphylococcus aureus subsp. aureus JH9     CTP synthase
gb|ABR53030.1 Staphylococcus aureus subsp. aureus JH1     CTP synthase
gb|ABX30112.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     CTP synthase
gb|EEI94549.1 Staphylococcus aureus subsp. aureus MN8     CTP synthetase
gb|EEJ61961.1 Staphylococcus aureus subsp. aureus TCH60     CTP synthetase
gb|EES56811.1 Staphylococcus aureus subsp. aureus TCH70     CTP synthetase
gb|EES93952.1 Staphylococcus aureus subsp. aureus USA300_TCH959     CTP synthetase
gb|EES97676.1 Staphylococcus aureus subsp. aureus TCH130     CTP synthetase
gb|EEV03145.1 Staphylococcus aureus subsp. aureus 55/2053     CTP synthase
gb|EEV11027.1 Staphylococcus aureus subsp. aureus E1410     CTP synthetase
gb|EEV13676.1 Staphylococcus aureus subsp. aureus M876     CTP synthase
gb|EEV26197.1 Staphylococcus aureus A9781     CTP synthase
gb|EEV65830.1 Staphylococcus aureus A9763     CTP synthetase
gb|EEV66407.1 Staphylococcus aureus A9719     CTP synthase
gb|EEV73266.1 Staphylococcus aureus A9299     CTP synthetase
gb|EEV76438.1 Staphylococcus aureus A8115     CTP synthetase
gb|EEV78435.1 Staphylococcus aureus A6300     CTP synthetase
gb|EEV79493.1 Staphylococcus aureus A6224     CTP synthetase
gb|EEV81966.1 Staphylococcus aureus A5948     CTP synthase
gb|EEV87159.1 Staphylococcus aureus A5937     CTP synthase
gb|EEW44548.1 Staphylococcus aureus 930918-3     CTP synthetase
gb|EEW47226.1 Staphylococcus aureus D30     CTP synthetase
gi|119391182 organism not parsed/found in ncbi nr NCBI   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
gi|119391184 organism not parsed/found in ncbi nr NCBI   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
gi|13701921 Staphylococcus aureus subsp. aureus N315 NCBI   CTP synthase
gi|14247900 Staphylococcus aureus subsp. aureus Mu50 NCBI   CTP synthase
gi|147741647 Staphylococcus aureus subsp. aureus JH9 NCBI   CTP synthase
gi|148268578 Staphylococcus aureus subsp. aureus JH9 NCBI   CTP synthetase
gi|149947094 Staphylococcus aureus subsp. aureus JH1 NCBI   CTP synthase
gi|150375043 Staphylococcus aureus subsp. aureus str. Newman NCBI   CTP synthase
gi|150394642 Staphylococcus aureus subsp. aureus JH1 NCBI   CTP synthetase
gi|151222243 Staphylococcus aureus subsp. aureus str. Newman NCBI   CTP synthetase
gi|156722577 Staphylococcus aureus subsp. aureus Mu3 NCBI   CTP synthase
gi|156980442 Staphylococcus aureus subsp. aureus Mu3 NCBI   CTP synthetase
gi|15925117 Staphylococcus aureus subsp. aureus Mu50 NCBI   CTP synthetase
gi|15927701 Staphylococcus aureus subsp. aureus N315 NCBI   CTP synthetase
gi|160369141 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   CTP synthase
gi|161510332 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   CTP synthetase
gi|21205222 Staphylococcus aureus subsp. aureus MW2 NCBI   CTP synthase
gi|21283780 Staphylococcus aureus subsp. aureus MW2 NCBI   CTP synthetase
gi|221137025 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   CTP synthetase
gi|221141646 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   CTP synthetase
gi|226733194 organism not parsed/found in ncbi nr NCBI   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
gi|226733195 organism not parsed/found in ncbi nr NCBI   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
gi|226733196 organism not parsed/found in ncbi nr NCBI   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
gi|226733197 organism not parsed/found in ncbi nr NCBI   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
gi|226733198 organism not parsed/found in ncbi nr NCBI   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
gi|227244790 Staphylococcus aureus subsp. aureus MN8 NCBI   CTP synthetase
gi|227558785 Staphylococcus aureus subsp. aureus MN8 NCBI   CTP synthetase
gi|227852163 Staphylococcus aureus subsp. aureus TCH60 NCBI   CTP synthetase
gi|227899529 Staphylococcus aureus subsp. aureus TCH60 NCBI   CTP synthetase
gi|251804154 Staphylococcus aureus subsp. aureus TCH70 NCBI   CTP synthetase
gi|251812302 Staphylococcus aureus subsp. aureus TCH70 NCBI   CTP synthetase
gi|253315796 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   CTP synthetase
gi|253725223 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   CTP synthetase
gi|253728947 Staphylococcus aureus subsp. aureus TCH130 NCBI   CTP synthetase
gi|253731035 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   CTP synthetase
gi|253733039 Staphylococcus aureus subsp. aureus TCH130 NCBI   CTP synthetase
gi|255006915 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   CTP synthetase
gi|257270972 Staphylococcus aureus subsp. aureus 55/2053 NCBI   CTP synthase
gi|257280882 Staphylococcus aureus subsp. aureus E1410 NCBI   CTP synthetase
gi|257283549 Staphylococcus aureus subsp. aureus M876 NCBI   CTP synthase
gi|257426267 Staphylococcus aureus subsp. aureus 55/2053 NCBI   CTP synthase
gi|257434243 Staphylococcus aureus subsp. aureus E1410 NCBI   CTP synthetase
gi|257437156 Staphylococcus aureus subsp. aureus M876 NCBI   CTP synthase
gi|257787857 Staphylococcus aureus A9781 NCBI   CTP synthase
gi|257793885 Staphylococcus aureus A9781 NCBI   CTP synthase
gi|257841386 Staphylococcus aureus A9763 NCBI   CTP synthetase
gi|257841975 Staphylococcus aureus A9719 NCBI   CTP synthase
gi|257849287 Staphylococcus aureus A9299 NCBI   CTP synthetase
gi|257852520 Staphylococcus aureus A8115 NCBI   CTP synthetase
gi|257855498 Staphylococcus aureus A6300 NCBI   CTP synthetase
gi|257856587 Staphylococcus aureus A6224 NCBI   CTP synthetase
gi|257859109 Staphylococcus aureus A5948 NCBI   CTP synthase
gi|257864413 Staphylococcus aureus A5937 NCBI   CTP synthase
gi|258407053 Staphylococcus aureus A9763 NCBI   CTP synthetase
gi|258422075 Staphylococcus aureus A9719 NCBI   CTP synthase
gi|258433556 Staphylococcus aureus A9299 NCBI   CTP synthetase
gi|258440451 Staphylococcus aureus A8115 NCBI   CTP synthetase
gi|258445659 Staphylococcus aureus A6300 NCBI   CTP synthetase
gi|258450113 Staphylococcus aureus A6224 NCBI   CTP synthetase
gi|258453163 Staphylococcus aureus A5948 NCBI   CTP synthase
gi|258453432 Staphylococcus aureus A5937 NCBI   CTP synthase
gi|259159498 Staphylococcus aureus 930918-3 NCBI   CTP synthetase
gi|259162659 Staphylococcus aureus D30 NCBI   CTP synthetase
gi|49242480 Staphylococcus aureus subsp. aureus MRSA252 NCBI   putative CTP synthase
gi|49245363 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative CTP synthase
gi|49484351 Staphylococcus aureus subsp. aureus MRSA252 NCBI   CTP synthetase
gi|49486920 Staphylococcus aureus subsp. aureus MSSA476 NCBI   CTP synthetase
gi|54038961 organism not parsed/found in ncbi nr NCBI   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
gi|54038992 organism not parsed/found in ncbi nr NCBI   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
gi|54041768 organism not parsed/found in ncbi nr NCBI   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
gi|57286335 Staphylococcus aureus subsp. aureus COL NCBI   CTP synthase
gi|57652149 Staphylococcus aureus subsp. aureus COL NCBI   CTP synthetase
gi|81648892 organism not parsed/found in ncbi nr NCBI   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
gi|81650644 organism not parsed/found in ncbi nr NCBI   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
gi|81694047 organism not parsed/found in ncbi nr NCBI   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
gi|82657259 Staphylococcus aureus RF122 NCBI   CTP synthase
gi|82751728 Staphylococcus aureus RF122 NCBI   CTP synthetase
gi|87126527 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   CTP synthase
gi|87160553 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   CTP synthetase
img|637093655 Staphylococcus aureus aureus N315 IMG   CTP synthetase( EC:6.3.4.2 )
img|637100675 Staphylococcus aureus aureus Mu50 IMG   CTP synthetase( EC:6.3.4.2 )
img|637152878 Staphylococcus aureus aureus COL IMG   CTP synthetase( EC:6.3.4.2 )
img|637155644 Staphylococcus aureus aureus MRSA252 IMG   CTP synthetase( EC:6.3.4.2 )
img|637158289 Staphylococcus aureus aureus MSSA476 IMG   CTP synthetase( EC:6.3.4.2 )
img|637299859 Staphylococcus aureus aureus MW2 IMG   CTP synthetase( EC:6.3.4.2 )
img|637816984 Staphylococcus aureus RF122 IMG   CTP synthase( EC:6.3.4.2 )
img|637888726 Staphylococcus aureus aureus USA300 IMG   CTP synthase( EC:6.3.4.2 )
img|639108970 Staphylococcus aureus aureus JH1 IMG   CTP synthase( EC:6.3.4.2 )
img|640566544 Staphylococcus aureus aureus JH9 IMG   CTP synthase( EC:6.3.4.2 )
img|640780308 Staphylococcus aureus aureus JH1 IMG   CTP synthase( EC:6.3.4.2 )
img|640796453 Staphylococcus aureus aureus Newman IMG   CTP synthase( EC:6.3.4.2 )
img|640904900 Staphylococcus aureus aureus Mu3 IMG   CTP synthase( EC:6.3.4.2 )
img|641310117 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   CTP synthase( EC:6.3.4.2 )
img|641771812 Staphylococcus aureus aureus USA300_TCH959 IMG   CTP synthase( EC:6.3.4.2 )
kegg|saa:SAUSA300_2081 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   CTP synthetase (EC:6.3.4.2)
kegg|sab:SAB2011c Staphylococcus aureus RF122 KEGG   CTP synthetase (EC:6.3.4.2)
kegg|sac:SACOL2119 Staphylococcus aureus subsp. aureus COL KEGG   CTP synthetase (EC:6.3.4.2)
kegg|sae:NWMN_2031 Staphylococcus aureus subsp. aureus Newman KEGG   CTP synthetase (EC:6.3.4.2)
kegg|sah:SaurJH1_2201 Staphylococcus aureus subsp. aureus JH1 KEGG   CTP synthetase (EC:6.3.4.2)
kegg|saj:SaurJH9_2163 Staphylococcus aureus subsp. aureus JH9 KEGG   CTP synthetase (EC:6.3.4.2)
kegg|sam:MW2051 Staphylococcus aureus subsp. aureus MW2 KEGG   CTP synthetase (EC:6.3.4.2)
kegg|sar:SAR2215   KEGG   CTP synthetase (EC:6.3.4.2)
kegg|sas:SAS2030   KEGG   CTP synthetase (EC:6.3.4.2)
kegg|sau:SA1929   KEGG   CTP synthetase (EC:6.3.4.2)
kegg|sav:SAV2127   KEGG   CTP synthetase (EC:6.3.4.2)
kegg|saw:SAHV_2111 Staphylococcus aureus subsp. aureus Mu3 KEGG   CTP synthetase
kegg|sax:USA300HOU_2115 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   CTP synthetase (EC:6.3.4.2)
ref|NP_372651.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   CTP synthetase
ref|NP_375234.1 Staphylococcus aureus subsp. aureus N315 RefSeq   CTP synthetase
ref|NP_646868.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   CTP synthetase
ref|YP_001247521.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   CTP synthetase
ref|YP_001317317.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   CTP synthetase
ref|YP_001333065.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   CTP synthetase
ref|YP_001442701.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   CTP synthetase
ref|YP_001575991.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   CTP synthetase
ref|YP_041575.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   CTP synthetase
ref|YP_044141.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   CTP synthetase
ref|YP_186934.1 Staphylococcus aureus subsp. aureus COL RefSeq   CTP synthetase
ref|YP_417469.1 Staphylococcus aureus RF122 RefSeq   CTP synthetase
ref|YP_494727.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   CTP synthetase
ref|ZP_03561836.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   CTP synthetase
ref|ZP_03566139.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   CTP synthetase
ref|ZP_03988832.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   CTP synthetase
ref|ZP_04017334.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   CTP synthetase
ref|ZP_04826775.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   CTP synthetase
ref|ZP_04839009.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   CTP synthetase
ref|ZP_04865200.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   CTP synthetase
ref|ZP_04867204.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   CTP synthetase
ref|ZP_05145516.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   CTP synthetase
ref|ZP_05602682.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   CTP synthase
ref|ZP_05610593.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   CTP synthetase
ref|ZP_05613196.1 Staphylococcus aureus subsp. aureus M876 RefSeq   CTP synthase
ref|ZP_05642864.1 Staphylococcus aureus A9781 RefSeq   CTP synthase
ref|ZP_05680203.1 Staphylococcus aureus A9763 RefSeq   CTP synthetase
ref|ZP_05684992.1 Staphylococcus aureus A9719 RefSeq   CTP synthase
ref|ZP_05688629.1 Staphylococcus aureus A9299 RefSeq   CTP synthetase
ref|ZP_05690621.1 Staphylococcus aureus A8115 RefSeq   CTP synthetase
ref|ZP_05693837.1 Staphylococcus aureus A6300 RefSeq   CTP synthetase
ref|ZP_05698208.1 Staphylococcus aureus A6224 RefSeq   CTP synthetase
ref|ZP_05701154.1 Staphylococcus aureus A5948 RefSeq   CTP synthase
ref|ZP_05701414.1 Staphylococcus aureus A5937 RefSeq   CTP synthase
sp|A5IUS2 Staphylococcus aureus (strain JH9) SwissProt   CTP synthase
sp|A6QIX1 Staphylococcus aureus (strain Newman) SwissProt   CTP synthase
sp|A6U3L2 Staphylococcus aureus (strain JH1) SwissProt   CTP synthase
sp|A7X4X7 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   CTP synthase
sp|A8YY92 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   CTP synthase
sp|P65923 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   CTP synthase
sp|P65924 Staphylococcus aureus (strain MW2) SwissProt   CTP synthase
sp|P99072 Staphylococcus aureus (strain N315) SwissProt   CTP synthase
sp|PYRG_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
sp|PYRG_STAA2 organism not parsed/found in ncbi nr SwissProt   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
sp|PYRG_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
sp|PYRG_STAA9 organism not parsed/found in ncbi nr SwissProt   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
sp|PYRG_STAAB organism not parsed/found in ncbi nr SwissProt   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
sp|PYRG_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
sp|PYRG_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
sp|PYRG_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
sp|PYRG_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
sp|PYRG_STAAR organism not parsed/found in ncbi nr SwissProt   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
sp|PYRG_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
sp|PYRG_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
sp|PYRG_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=CTP synthase; AltName: Full=UTP--ammonia ligase; AltName: Full=CTP synthetase
sp|Q2FF01 Staphylococcus aureus (strain USA300) SwissProt   CTP synthase
sp|Q2YUM6 Staphylococcus aureus (strain bovine RF122 / ET3-1) SwissProt   CTP synthase
sp|Q5HE73 Staphylococcus aureus (strain COL) SwissProt   CTP synthase
sp|Q6G7I3 Staphylococcus aureus (strain MSSA476) SwissProt   CTP synthase
sp|Q6GEU8 Staphylococcus aureus (strain MRSA252) SwissProt   CTP synthase
tr|C2GAF1 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   CTP synthetase
tr|C2K9P2 Staphylococcus aureus subsp. aureus MN8 TrEMBL   CTP synthetase
tr|C5N2K8 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   CTP synthetase
tr|C5PZ85 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   CTP synthetase
tr|C5QDD8 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   CTP synthetase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
6 fig|93062.19.peg.2061 UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC 2.5.1.7)
8 fig|93062.19.peg.2062 Fructose-bisphosphate aldolase class II (EC 4.1.2.13)
7 fig|93062.19.peg.2065 Transcription delta factor


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search