The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.1916: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
Translate Function Assignments



Context on contig NC_002951 from base 2017126 to 2028695 (11570 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1911 2018487 2017126 1362 -   6 1: 7   RNA methyltransferase, TrmA family locus|SACOL1957, protein_id|YP_186782.1, gi|57652118, geneID|3237496
1912 2019515 2018568 948 - 80 9     Diacylglycerol kinase, Bacillus type (EC 2.7.1.107) locus|SACOL1958, protein_id|YP_186783.1, gi|57652119, geneID|3237497
1913 2020244 2020098 147 - 582         FIG01107968: hypothetical protein  
1914 2021711 2020284 1428 - 39 37 1: 1   Aspartyl-tRNA(Asn) amidotransferase subunit B (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit B (EC 6.3.5.7) gene_name|gatB, locus|SACOL1960, protein_id|YP_186784.1, gi|57652120, geneID|3237498
1915 2023181 2021724 1458 - 12 61 1: 1   Aspartyl-tRNA(Asn) amidotransferase subunit A (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.7) gene_name|gatA, locus|SACOL1961, protein_id|YP_186785.1, gi|57652121, geneID|3237499
1916 2023485 2023183 303 - 1   1: 1   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7) gene_name|gatC, locus|SACOL1962, protein_id|YP_186786.1, gi|57652122, geneID|3237500
1917 2023853 2025391 1539 + 367     2: 2 4   Pantothenate:Na+ symporter (TC 2.A.21.1.1) locus|SACOL1963, protein_id|YP_186787.1, gi|57652123, geneID|3237501
1918 2026679 2025480 1200 - 88 10 1: 6   Putative pheromone cAM373 precursor lipoprotein CamS gene_name|camS, locus|SACOL1964, protein_id|YP_186788.1, gi|57650654, geneID|3238098
1919 2028695 2026692 2004 - 12 17 3: 5 8 3   DNA ligase (EC 6.5.1.2) gene_name|ligA, locus|SACOL1965, protein_id|YP_186789.1, gi|57650655, geneID|3238150

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
tRNA_aminoacylation,_Glu_and_Gln gjo Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)


  Protein Sequence

>fig|93062.19.peg.1916 Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
MTKVTREEVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQ
NVLREDKAIKGIPQELALKNAKETEDGQFKVPTIMNEEDA

MD5 = 9ea2392f25552321db7acc20268789fe


  DNA Sequence

>fig|93062.19.peg.1916 Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
atgacaaaagtaacacgtgaagaagttgagcatatcgcgaatcttgcaagacttcaaatt
tctcctgaagaaacggaagaaatggccaacacattagaaagcattttagattttgcaaaa
caaaatgatagcgctgatacagaaggcgttgaacctacatatcacgttttagatttacaa
aacgttttacgtgaagataaagcaattaaaggtattccacaagaattagctttgaaaaat
gccaaagaaacagaagatggacaatttaaagtgcctacaatcatgaatgaggaggacgcg
taa


  DNA with Flanking Sequence

>fig|93062.19.peg.1916 Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
ttaggttaccagttgcttgcttgtaaccgtaaaagccaataacgattagtatcaagaagt
agacggcaatcataatataagtttgccaattggcatctacttgttgacttaatgctgtcc
ccattgtaagcatgataaacactccctttatttaatttataatttagttacttgaaaaca
ttatacataaagataaatgtttagaaaagtagtaaaattaaatttattctttttgaaata
cttgcataccaatatagaaagcgctttcgtattttttggatatgagcaaatttttataat
taaaattgcataatcataatattgaattgggttgtctaatattaaaagagtgttgttttt
cataaaaaatgatttgataaacgaatgataatgtttatacagtttatatgaaattaaagt
agcacctcataaatacttagatttttaattggaaatttgatacaatttagtgatgaatga
cttaaaggaggcttttattaatgacaaaagtaacacgtgaagaagttgagcatatcgcga
atcttgcaagacttcaaatttctcctgaagaaacggaagaaatggccaacacattagaaa
gcattttagattttgcaaaacaaaatgatagcgctgatacagaaggcgttgaacctacat
atcacgttttagatttacaaaacgttttacgtgaagataaagcaattaaaggtattccac
aagaattagctttgaaaaatgccaaagaaacagaagatggacaatttaaagtgcctacaa
tcatgaatgaggaggacgcgtaagatgagcattcgctacgaatcggttgagaatttatta
actttaataaaagacaaaaaaatcaaaccatctgatgttgttaaagatatatatgatgca
attgaagagactgatccaacaattaagtcttttctagcgctggataaagaaaatgcaatc
aaaaaagcgcaagaattggatgaattacaagcaaaagatcaaatggatggcaaattattt
ggtattccaatgggtataaaagataacattattacaaacggattagaaacaacatgtgca
agtaaaatgttagaaggttttgtgccaatttacgaatctactgtaatggaaaaactacat
aatgaaaatgccgttttaatcggtaaattaaatatggatgagtttgcaatgggtggttca
acagaaacatcttatttcaaaaaaacagttaacccatttgaccataaagcagtgccaggt
ggttcatcaggtggatctgcagcagcagttgcagctggcttag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005524       F:ATP binding
GO:0006412       P:translation
GO:0006450       P:regulation of translational fidelity
GO:0016740       F:transferase activity
GO:0050567       F:glutaminyl-tRNA synthase (glutamine-hydroly...
cmr|NT01SA1881 Staphylococcus aureus N315     glutamyl-tRNA(Gln) amidotransferase, C subunit
cmr|NT02SA1913 Staphylococcus aureus Mu50     glutamyl-tRNA(Gln) amidotransferase, C subunit
cmr|NT03SA1997 Staphylococcus aureus MW2     glutamyl-tRNA(Gln) amidotransferase, C subunit
cmr|NT05SA1915 Staphylococcus aureus NCTC 8325     glutamyl-tRNA(Gln) amidotransferase, C subunit
cmr|NT08SA1976 Staphylococcus aureus subsp. aureus MRSA252     glutamyl-tRNA(Gln) amidotransferase, C subunit
cmr|NT09SA1844 Staphylococcus aureus subsp. aureus MSSA476     glutamyl-tRNA(Gln) amidotransferase, C subunit
cmr|NT11SA1851 Staphylococcus aureus RF122     glutamyl-tRNA(Gln) amidotransferase, C subunit
cmr|SACOL1962 Staphylococcus aureus subsp. aureus COL     glutamyl-tRNA(Gln) amidotransferase, C subunit
cmr|SAUSA300_1882 Staphylococcus aureus subsp. aureus USA300-FPR3757     aspartyl/glutamyl-tRNA amidotransferase subunit C
dbj|BAB42987.1 Staphylococcus aureus subsp. aureus N315     glutamyl-tRNAGln amidotransferase subunit C
dbj|BAB58063.1 Staphylococcus aureus subsp. aureus Mu50     glutamyl-tRNAGln amidotransferase subunit C
dbj|BAB95707.1 Staphylococcus aureus subsp. aureus MW2     glutamyl-tRNAGln amidotransferase subunit C
dbj|BAF78769.1 Staphylococcus aureus subsp. aureus Mu3     glutamyl-tRNAGln amidotransferase subunit C
emb|CAG40978.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   glutamyl-tRNA amidotransferase subunit C
emb|CAG43629.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   glutamyl-tRNA amidotransferase subunit C
emb|CAI81523.1 Staphylococcus aureus RF122 EMBL   glutamyl-tRNA amidotransferase subunit C
fig|158878.1.peg.1901 Staphylococcus aureus subsp. aureus Mu50 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|158878.14.peg.1968 Staphylococcus aureus subsp. aureus Mu50 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|158879.1.peg.1770 Staphylococcus aureus subsp. aureus N315 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|158879.11.peg.1853 Staphylococcus aureus subsp. aureus N315 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|196620.1.peg.1842 Staphylococcus aureus subsp. aureus MW2 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|196620.5.peg.1916 Staphylococcus aureus subsp. aureus MW2 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|273036.3.peg.1777 Staphylococcus aureus RF122 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|273036.6.peg.1943 Staphylococcus aureus RF122 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|282458.1.peg.1883 Staphylococcus aureus subsp. aureus MRSA252 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|282458.4.peg.2005 Staphylococcus aureus subsp. aureus MRSA252 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|282459.1.peg.1808 Staphylococcus aureus subsp. aureus MSSA476 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|282459.5.peg.1901 Staphylococcus aureus subsp. aureus MSSA476 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|359786.13.peg.2070 Staphylococcus aureus subsp. aureus JH9 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|359786.3.peg.562 Staphylococcus aureus subsp. aureus JH9 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|359787.11.peg.2041 Staphylococcus aureus subsp. aureus JH1 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|359787.3.peg.2677 Staphylococcus aureus subsp. aureus JH1 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|367830.3.peg.1939 Staphylococcus aureus subsp. aureus USA300 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|418127.4.peg.1758 Staphylococcus aureus subsp. aureus Mu3 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|418127.6.peg.1940 Staphylococcus aureus subsp. aureus Mu3 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|450394.6.peg.2420 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|451515.3.peg.2006 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|451516.9.peg.1996 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|452948.4.peg.2024 Staphylococcus aureus 930918-3 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|455227.3.peg.2043 Staphylococcus aureus D30 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|505321.3.peg.2461 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|546342.3.peg.2103 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|546343.3.peg.363 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|548470.3.peg.1942 Staphylococcus aureus subsp. aureus MN8 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|548473.3.peg.2609 Staphylococcus aureus subsp. aureus TCH60 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|548474.3.peg.2577 Staphylococcus aureus subsp. aureus TCH130 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|548475.3.peg.2505 Staphylococcus aureus subsp. aureus TCH70 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|553565.3.peg.44 Staphylococcus aureus A5937 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|553567.3.peg.510 Staphylococcus aureus A5948 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|553568.3.peg.202 Staphylococcus aureus A6224 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|553571.3.peg.369 Staphylococcus aureus A6300 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|553573.3.peg.1256 Staphylococcus aureus A8115 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|553574.3.peg.1899 Staphylococcus aureus A8117 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|553577.3.peg.2242 Staphylococcus aureus A8796 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|553580.3.peg.2424 Staphylococcus aureus A8819 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|553581.3.peg.407 Staphylococcus aureus A9299 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|553583.3.peg.496 Staphylococcus aureus A9635 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|553588.3.peg.1332 Staphylococcus aureus A9719 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|553590.4.peg.1516 Staphylococcus aureus A9754 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|553592.3.peg.1184 Staphylococcus aureus A9763 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|553594.3.peg.1599 Staphylococcus aureus A9765 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|553596.3.peg.611 Staphylococcus aureus A9781 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|553601.3.peg.1589 Staphylococcus aureus A10102 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|585143.3.peg.2457 Staphylococcus aureus subsp. aureus 55/2053 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|585144.3.peg.2473 Staphylococcus aureus subsp. aureus 58-424 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|585145.3.peg.2459 Staphylococcus aureus subsp. aureus 65-1322 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|585146.3.peg.2439 Staphylococcus aureus subsp. aureus 68-397 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|585147.3.peg.1439 Staphylococcus aureus subsp. aureus A017934/97 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|585148.3.peg.1497 Staphylococcus aureus subsp. aureus Btn1260 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|585149.6.peg.2080 Staphylococcus aureus subsp. aureus C101 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|585150.3.peg.2506 Staphylococcus aureus subsp. aureus C160 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|585151.3.peg.1594 Staphylococcus aureus subsp. aureus C427 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|585152.3.peg.1877 Staphylococcus aureus subsp. aureus D139 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|585153.3.peg.2528 Staphylococcus aureus subsp. aureus E1410 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|585154.3.peg.1944 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|585155.3.peg.2495 Staphylococcus aureus subsp. aureus H19 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|585156.3.peg.1457 Staphylococcus aureus subsp. aureus M1015 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|585157.3.peg.1108 Staphylococcus aureus subsp. aureus M809 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|585158.3.peg.2445 Staphylococcus aureus subsp. aureus M876 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|585159.3.peg.1972 Staphylococcus aureus subsp. aureus M899 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|585160.3.peg.1442 Staphylococcus aureus subsp. aureus WBG10049 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|585161.3.peg.1744 Staphylococcus aureus subsp. aureus WW2703/97 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|585891.3.peg.1966 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|644279.4.peg.2053 Staphylococcus aureus subsp. aureus 132 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|680649.3.peg.1013 Staphylococcus aureus subsp. aureus MR1 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|681288.4.peg.1937 Staphylococcus aureus subsp. aureus ED98 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|703339.3.peg.1897 Staphylococcus aureus 04-02981 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|762962.3.peg.2491 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|93061.3.peg.2002 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|93061.5.peg.1922 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
fig|93062.4.peg.377 Staphylococcus aureus subsp. aureus COL FIG   Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)
gb|AAF18135.1 Staphylococcus aureus     glutamyl-tRNAGln amidotransferase subunit C
gb|AAW38402.1 Staphylococcus aureus subsp. aureus COL     glutamyl-tRNA(Gln) amidotransferase, C subunit
gb|ABD21047.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     aspartyl/glutamyl-tRNA amidotransferase subunit C
gb|ABD31168.1 Staphylococcus aureus subsp. aureus NCTC 8325     glutamyl-tRNA(Gln) amidotransferase, C subunit
gb|ABQ49741.1 Staphylococcus aureus subsp. aureus JH9     aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
gb|ABR52824.1 Staphylococcus aureus subsp. aureus JH1     glutamyl-tRNA(Gln) amidotransferase, C subunit
gb|ABX29904.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     glutamyl-tRNA(Gln) amidotransferase subunit C
gb|AF205033_1 Staphylococcus aureus     glutamyl-tRNAGln amidotransferase subunit C
gb|EEI95799.1 Staphylococcus aureus subsp. aureus MN8     aspartyl/glutamyl-tRNA amidotransferase subunit C
gb|EEJ63495.1 Staphylococcus aureus subsp. aureus TCH60     aspartyl/glutamyl-tRNA amidotransferase subunit C
gb|EES54115.1 Staphylococcus aureus subsp. aureus TCH70     aspartyl/glutamyl-tRNA amidotransferase subunit C
gb|EES95294.1 Staphylococcus aureus subsp. aureus USA300_TCH959     aspartyl/glutamyl-tRNA amidotransferase subunit C
gb|EES95900.1 Staphylococcus aureus subsp. aureus TCH130     aspartyl/glutamyl-tRNA amidotransferase subunit C
gb|EEV03333.1 Staphylococcus aureus subsp. aureus 55/2053     glutamyl-tRNAGln amidotransferase subunit C
gb|EEV05862.1 Staphylococcus aureus subsp. aureus 65-1322     glutamyl-tRNAGln amidotransferase subunit C
gb|EEV08621.1 Staphylococcus aureus subsp. aureus 68-397     glutamyl-tRNA(Gln) amidotransferase
gb|EEV11104.1 Staphylococcus aureus subsp. aureus E1410     glutamyl-tRNAGln amidotransferase subunit C
gb|EEV13852.1 Staphylococcus aureus subsp. aureus M876     glutamyl-tRNA(Gln) amidotransferase
gb|EEV26057.1 Staphylococcus aureus A9781     glutamyl-tRNAGln amidotransferase subunit C
gb|EEV64796.1 Staphylococcus aureus A9763     glutamyl-tRNAGln amidotransferase subunit C
gb|EEV67375.1 Staphylococcus aureus A9719     glutamyl-tRNAGln amidotransferase subunit C
gb|EEV70780.1 Staphylococcus aureus A9635     glutamyl-tRNAGln amidotransferase subunit C
gb|EEV73581.1 Staphylococcus aureus A9299     glutamyl-tRNAGln amidotransferase subunit C
gb|EEV75288.1 Staphylococcus aureus A8115     glutamyl-tRNAGln amidotransferase subunit C
gb|EEV78763.1 Staphylococcus aureus A6300     glutamyl-tRNA(Gln) amidotransferase subunit C
gb|EEV81686.1 Staphylococcus aureus A6224     glutamyl-tRNAGln amidotransferase subunit C
gb|EEV84087.1 Staphylococcus aureus A5948     glutamyl-tRNAGln amidotransferase subunit C
gb|EEV87269.1 Staphylococcus aureus A5937     glutamyl-tRNAGln amidotransferase subunit C
gb|EEW44357.1 Staphylococcus aureus 930918-3     glutamyl-tRNAGln amidotransferase subunit C
gb|EEW46535.1 Staphylococcus aureus D30     glutamyl-tRNAGln amidotransferase subunit C
gi|112490473 organism not parsed/found in ncbi nr NCBI   Chain C, Structure Of Trna-Dependent Amidotransferase Gatcab Complexed With Mn2+
gi|112490492 organism not parsed/found in ncbi nr NCBI   Chain C, Structure Of Trna-Dependent Amidotransferase Gatcab Complexed With Asn
gi|112490543 organism not parsed/found in ncbi nr NCBI   Chain C, Structure Of Trna-Dependent Amidotransferase Gatcab Complexed With Gln
gi|112490677 organism not parsed/found in ncbi nr NCBI   Chain C, Structure Of Trna-Dependent Amidotransferase Gatcab
gi|112490682 organism not parsed/found in ncbi nr NCBI   Chain C, Structure Of Trna-Dependent Amidotransferase Gatcab Complexed With Adp-Alf4
gi|122539111 organism not parsed/found in ncbi nr NCBI   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
gi|123485183 organism not parsed/found in ncbi nr NCBI   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
gi|123548137 organism not parsed/found in ncbi nr NCBI   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
gi|13701694 Staphylococcus aureus subsp. aureus N315 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|14247673 Staphylococcus aureus subsp. aureus Mu50 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|147741443 Staphylococcus aureus subsp. aureus JH9 NCBI   aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
gi|148268374 Staphylococcus aureus subsp. aureus JH9 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|149946888 Staphylococcus aureus subsp. aureus JH1 NCBI   glutamyl-tRNA(Gln) amidotransferase, C subunit
gi|150394436 Staphylococcus aureus subsp. aureus JH1 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|156722352 Staphylococcus aureus subsp. aureus Mu3 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|156980217 Staphylococcus aureus subsp. aureus Mu3 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|15924891 Staphylococcus aureus subsp. aureus Mu50 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|15927475 Staphylococcus aureus subsp. aureus N315 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|160368933 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   glutamyl-tRNA(Gln) amidotransferase subunit C
gi|161510124 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|166218184 organism not parsed/found in ncbi nr NCBI   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
gi|189045176 organism not parsed/found in ncbi nr NCBI   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
gi|189045177 organism not parsed/found in ncbi nr NCBI   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
gi|189045178 organism not parsed/found in ncbi nr NCBI   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
gi|21205012 Staphylococcus aureus subsp. aureus MW2 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|21283571 Staphylococcus aureus subsp. aureus MW2 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|221139059 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|221140354 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|227246040 Staphylococcus aureus subsp. aureus MN8 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|227557546 Staphylococcus aureus subsp. aureus MN8 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|227853697 Staphylococcus aureus subsp. aureus TCH60 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|227898007 Staphylococcus aureus subsp. aureus TCH60 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|251801458 Staphylococcus aureus subsp. aureus TCH70 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|251815042 Staphylococcus aureus subsp. aureus TCH70 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|253316910 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|253726565 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|253727171 Staphylococcus aureus subsp. aureus TCH130 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|253729679 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|253734989 Staphylococcus aureus subsp. aureus TCH130 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|255006688 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|257271176 Staphylococcus aureus subsp. aureus 55/2053 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|257274350 Staphylococcus aureus subsp. aureus 65-1322 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|257277965 Staphylococcus aureus subsp. aureus 68-397 NCBI   glutamyl-tRNA(Gln) amidotransferase
gi|257280960 Staphylococcus aureus subsp. aureus E1410 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|257283727 Staphylococcus aureus subsp. aureus M876 NCBI   glutamyl-tRNA(Gln) amidotransferase
gi|257426033 Staphylococcus aureus subsp. aureus 55/2053 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|257428706 Staphylococcus aureus subsp. aureus 65-1322 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|257431316 Staphylococcus aureus subsp. aureus 68-397 NCBI   glutamyl-tRNA(Gln) amidotransferase
gi|257434034 Staphylococcus aureus subsp. aureus E1410 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|257436938 Staphylococcus aureus subsp. aureus M876 NCBI   glutamyl-tRNA(Gln) amidotransferase
gi|257787717 Staphylococcus aureus A9781 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|257793745 Staphylococcus aureus A9781 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|257840334 Staphylococcus aureus A9763 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|257842957 Staphylococcus aureus A9719 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|257846765 Staphylococcus aureus A9635 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|257849613 Staphylococcus aureus A9299 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|257851348 Staphylococcus aureus A8115 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|257855839 Staphylococcus aureus A6300 NCBI   glutamyl-tRNA(Gln) amidotransferase subunit C
gi|257858817 Staphylococcus aureus A6224 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|257861275 Staphylococcus aureus A5948 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|257864526 Staphylococcus aureus A5937 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|258408887 Staphylococcus aureus A9763 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|258421009 Staphylococcus aureus A9719 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|258422978 Staphylococcus aureus A9635 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|258430019 Staphylococcus aureus A9299 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|258443463 Staphylococcus aureus A8115 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|258445321 Staphylococcus aureus A6300 NCBI   glutamyl-tRNA(Gln) amidotransferase subunit C
gi|258447885 Staphylococcus aureus A6224 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|258451033 Staphylococcus aureus A5948 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|258453318 Staphylococcus aureus A5937 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|259159300 Staphylococcus aureus 930918-3 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|259161953 Staphylococcus aureus D30 NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|49242271 Staphylococcus aureus subsp. aureus MRSA252 NCBI   glutamyl-tRNA amidotransferase subunit C
gi|49245163 Staphylococcus aureus subsp. aureus MSSA476 NCBI   glutamyl-tRNA amidotransferase subunit C
gi|49484142 Staphylococcus aureus subsp. aureus MRSA252 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|49486720 Staphylococcus aureus subsp. aureus MSSA476 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|56748959 organism not parsed/found in ncbi nr NCBI   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
gi|56749013 organism not parsed/found in ncbi nr NCBI   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
gi|56749851 organism not parsed/found in ncbi nr NCBI   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
gi|56749852 organism not parsed/found in ncbi nr NCBI   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
gi|56749853 organism not parsed/found in ncbi nr NCBI   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
gi|56749854 organism not parsed/found in ncbi nr NCBI   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
gi|57286308 Staphylococcus aureus subsp. aureus COL NCBI   glutamyl-tRNA(Gln) amidotransferase, C subunit
gi|57652122 Staphylococcus aureus subsp. aureus COL NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|6578923 Staphylococcus aureus NCBI   glutamyl-tRNAGln amidotransferase subunit C
gi|71152066 organism not parsed/found in ncbi nr NCBI   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
gi|82657086 Staphylococcus aureus RF122 NCBI   glutamyl-tRNA amidotransferase subunit C
gi|82751555 Staphylococcus aureus RF122 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|87126533 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|87160559 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
gi|87203358 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   glutamyl-tRNA(Gln) amidotransferase, C subunit
gi|88195800 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   aspartyl/glutamyl-tRNA amidotransferase subunit C
img|637093424 Staphylococcus aureus aureus N315 IMG   glutamyl-tRNAGln amidotransferase subunit C
img|637100447 Staphylococcus aureus aureus Mu50 IMG   glutamyl-tRNAGln amidotransferase subunit C
img|637152725 Staphylococcus aureus aureus COL IMG   glutamyl-tRNA(Gln) amidotransferase, C subunit( EC:6.3.5.- )
img|637155430 Staphylococcus aureus aureus MRSA252 IMG   glutamyl-tRNA amidotransferase subunit C( EC:6.3.5.- )
img|637158084 Staphylococcus aureus aureus MSSA476 IMG   glutamyl-tRNA amidotransferase subunit C( EC:6.3.5.- )
img|637299645 Staphylococcus aureus aureus MW2 IMG   glutamyl-tRNAGln amidotransferase subunit C
img|637816805 Staphylococcus aureus RF122 IMG   glutamyl-tRNA amidotransferase subunit C( EC:6.3.5.- )
img|637888528 Staphylococcus aureus aureus USA300 IMG   aspartyl/glutamyl-tRNA amidotransferase subunit C( EC:6.3.5.- )
img|637894744 Staphylococcus aureus aureus NCTC 8325 IMG   glutamyl-tRNA(Gln) amidotransferase, C subunit( EC:6.3.5.- )
img|639108805 Staphylococcus aureus aureus JH1 IMG   Glutamyl-tRNA(Gln) amidotransferase C subunit
img|640566333 Staphylococcus aureus aureus JH9 IMG   glutamyl-tRNA(Gln) amidotransferase, C subunit
img|640780097 Staphylococcus aureus aureus JH1 IMG   glutamyl-tRNA(Gln) amidotransferase, C subunit
img|640904670 Staphylococcus aureus aureus Mu3 IMG   glutamyl-tRNAGln amidotransferase subunit C
img|641309900 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   glutamyl-tRNA(Gln) amidotransferase subunit C( EC:6.3.5.- )
img|641771747 Staphylococcus aureus aureus USA300_TCH959 IMG   glutamyl-tRNA(Gln) amidotransferase subunit C
kegg|saa:SAUSA300_1882 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   aspartyl/glutamyl-tRNA amidotransferase subunit C (EC:6.3.5.-)
kegg|sab:SAB1834c Staphylococcus aureus RF122 KEGG   aspartyl/glutamyl-tRNA amidotransferase subunit C
kegg|sac:SACOL1962 Staphylococcus aureus subsp. aureus COL KEGG   aspartyl/glutamyl-tRNA amidotransferase subunit C (EC:6.3.5.-)
kegg|sah:SaurJH1_1990 Staphylococcus aureus subsp. aureus JH1 KEGG   aspartyl/glutamyl-tRNA amidotransferase subunit C
kegg|saj:SaurJH9_1956 Staphylococcus aureus subsp. aureus JH9 KEGG   aspartyl/glutamyl-tRNA amidotransferase subunit C
kegg|sam:MW1842 Staphylococcus aureus subsp. aureus MW2 KEGG   aspartyl/glutamyl-tRNA amidotransferase subunit C
kegg|sao:SAOUHSC_02118 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   aspartyl/glutamyl-tRNA amidotransferase subunit C (EC:6.3.5.-)
kegg|sar:SAR1993   KEGG   aspartyl/glutamyl-tRNA amidotransferase subunit C (EC:6.3.5.-)
kegg|sas:SAS1824   KEGG   aspartyl/glutamyl-tRNA amidotransferase subunit C (EC:6.3.5.-)
kegg|sau:SA1717   KEGG   aspartyl/glutamyl-tRNA amidotransferase subunit C
kegg|sav:SAV1901   KEGG   aspartyl/glutamyl-tRNA amidotransferase subunit C
kegg|saw:SAHV_1886 Staphylococcus aureus subsp. aureus Mu3 KEGG   aspartyl/glutamyl-tRNA amidotransferase subunit C
kegg|sax:USA300HOU_1902 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   aspartyl/glutamyl-tRNA amidotransferase subunit C (EC:6.3.5.-)
pdb|2DF4 organism not parsed/found in ncbi nr     Chain A, Structure Of Trna-Dependent Amidotransferase Gatcab Complexed With Mn2+
pdb|2DQN organism not parsed/found in ncbi nr     Chain A, Structure Of Trna-Dependent Amidotransferase Gatcab Complexed With Asn
pdb|2F2A organism not parsed/found in ncbi nr     Chain A, Structure Of Trna-Dependent Amidotransferase Gatcab Complexed With Gln
pdb|2G5H organism not parsed/found in ncbi nr     Chain A, Structure Of Trna-Dependent Amidotransferase Gatcab
pdb|2G5I organism not parsed/found in ncbi nr     Chain A, Structure Of Trna-Dependent Amidotransferase Gatcab Complexed With Adp-Alf4
pdb|C ((R)-1-Benzyloxycarbonylamino-Hexyl)- Hydroxy-Phosphinoyloxy     Chain C,
ref|NP_372425.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|NP_375008.1 Staphylococcus aureus subsp. aureus N315 RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|NP_646659.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|YP_001247317.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|YP_001317111.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|YP_001442476.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|YP_001575783.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|YP_041366.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|YP_043941.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|YP_186786.1 Staphylococcus aureus subsp. aureus COL RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|YP_417296.1 Staphylococcus aureus RF122 RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|YP_494534.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|YP_500610.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|ZP_03563859.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|ZP_03564847.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|ZP_03987593.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|ZP_04015812.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|ZP_04829515.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|ZP_04840123.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|ZP_04863844.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|ZP_04869154.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|ZP_05145289.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   aspartyl/glutamyl-tRNA amidotransferase subunit C
ref|ZP_05602455.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   glutamyl-tRNAGln amidotransferase subunit C
ref|ZP_05605101.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   glutamyl-tRNAGln amidotransferase subunit C
ref|ZP_05607692.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   glutamyl-tRNA(Gln) amidotransferase
ref|ZP_05610385.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   glutamyl-tRNAGln amidotransferase subunit C
ref|ZP_05612980.1 Staphylococcus aureus subsp. aureus M876 RefSeq   glutamyl-tRNA(Gln) amidotransferase
ref|ZP_05642724.1 Staphylococcus aureus A9781 RefSeq   glutamyl-tRNAGln amidotransferase subunit C
ref|ZP_05681169.1 Staphylococcus aureus A9763 RefSeq   glutamyl-tRNAGln amidotransferase subunit C
ref|ZP_05683940.1 Staphylococcus aureus A9719 RefSeq   glutamyl-tRNAGln amidotransferase subunit C
ref|ZP_05685877.1 Staphylococcus aureus A9635 RefSeq   glutamyl-tRNAGln amidotransferase subunit C
ref|ZP_05688389.1 Staphylococcus aureus A9299 RefSeq   glutamyl-tRNAGln amidotransferase subunit C
ref|ZP_05691805.1 Staphylococcus aureus A8115 RefSeq   glutamyl-tRNAGln amidotransferase subunit C
ref|ZP_05693512.1 Staphylococcus aureus A6300 RefSeq   glutamyl-tRNA(Gln) amidotransferase subunit C
ref|ZP_05696019.1 Staphylococcus aureus A6224 RefSeq   glutamyl-tRNAGln amidotransferase subunit C
ref|ZP_05699069.1 Staphylococcus aureus A5948 RefSeq   glutamyl-tRNAGln amidotransferase subunit C
ref|ZP_05701303.1 Staphylococcus aureus A5937 RefSeq   glutamyl-tRNAGln amidotransferase subunit C
sp|A5IU68 Staphylococcus aureus (strain JH9) SwissProt   Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
sp|A6U306 Staphylococcus aureus (strain JH1) SwissProt   Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
sp|A7X428 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
sp|A8Z2R5 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
sp|GATC_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
sp|GATC_STAA2 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
sp|GATC_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
sp|GATC_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
sp|GATC_STAA9 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
sp|GATC_STAAB organism not parsed/found in ncbi nr SwissProt   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
sp|GATC_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
sp|GATC_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
sp|GATC_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
sp|GATC_STAAR organism not parsed/found in ncbi nr SwissProt   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
sp|GATC_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
sp|GATC_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
sp|GATC_STAAU organism not parsed/found in ncbi nr SwissProt   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
sp|GATC_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C
sp|P68807 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
sp|P68808 Staphylococcus aureus (strain N315) SwissProt   Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
sp|P68809 Staphylococcus aureus SwissProt   Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
sp|P68810 Staphylococcus aureus (strain MW2) SwissProt   Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
sp|Q2FFJ4 Staphylococcus aureus (strain USA300) SwissProt   Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
sp|Q2FWY8 Staphylococcus aureus (strain NCTC 8325) SwissProt   Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
sp|Q2YU75 Staphylococcus aureus (strain bovine RF122 / ET3-1) SwissProt   Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
sp|Q5HEM1 Staphylococcus aureus (strain COL) SwissProt   Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
sp|Q6G832 Staphylococcus aureus (strain MSSA476) SwissProt   Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
sp|Q6GFF6 Staphylococcus aureus (strain MRSA252) SwissProt   Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
tr|C2G629 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   Aspartyl/glutamyl-tRNA amidotransferase subunit C
tr|C2K653 Staphylococcus aureus subsp. aureus MN8 TrEMBL   Aspartyl/glutamyl-tRNA amidotransferase subunit C
tr|C5MYQ6 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Aspartyl/glutamyl-tRNA amidotransferase subunit C
tr|C5Q4T5 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Aspartyl/glutamyl-tRNA amidotransferase subunit C
tr|C5QL49 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Aspartyl/glutamyl-tRNA amidotransferase subunit C


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
6 fig|93062.19.peg.1911 RNA methyltransferase, TrmA family
9 fig|93062.19.peg.1912 Diacylglycerol kinase, Bacillus type (EC 2.7.1.107)
37 fig|93062.19.peg.1914 Aspartyl-tRNA(Asn) amidotransferase subunit B (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit B (EC 6.3.5.7)
61 fig|93062.19.peg.1915 Aspartyl-tRNA(Asn) amidotransferase subunit A (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.7)
10 fig|93062.19.peg.1918 Putative pheromone cAM373 precursor lipoprotein CamS
17 fig|93062.19.peg.1919 DNA ligase (EC 6.5.1.2)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search