The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.190: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: M23/M37 peptidase domain protein
Translate Function Assignments



Context on contig NC_002951 from base 218528 to 231047 (12520 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
186 218528 220303 1776 +           RGD-containing lipoprotein locus|SACOL0187, protein_id|YP_185086.1, gi|57651203, geneID|3236719
187 220341 222347 2007 + 37     3: 5 1 4   Gamma-glutamyltranspeptidase (EC 2.3.2.2) gene_name|ggt, locus|SACOL0188, protein_id|YP_185087.1, gi|57651204, geneID|3236413
188 223418 222645 774 - 297         FIG01107907: hypothetical protein locus|SACOL0189, protein_id|YP_185088.1, gi|57651205, geneID|3236414
189 224234 223608 627 - 189         FMN-dependent NADH-azoreductase (EC 1.7.1.17) gene_name|acpD, locus|SACOL0190, protein_id|YP_185089.1, gi|57651206, geneID|3236415
190 224443 225021 579 + 208         M23/M37 peptidase domain protein locus|SACOL0191, protein_id|YP_185090.1, gi|57651207, geneID|3236416
191 225404 226501 1098 + 382         Maltose/maltodextrin transport ATP-binding protein MalK (EC 7.5.2.1); Maltodextrin ABC transporter, ATP-binding protein MsmX locus|SACOL0192, protein_id|YP_185091.1, gi|57651208, geneID|3236417
192 226514 227785 1272 + 12     2: 3 2   Maltodextrin ABC transporter, substrate-binding protein MdxE locus|SACOL0193, protein_id|YP_185092.1, gi|57651209, geneID|3236253
193 227788 229056 1269 + 2         Maltose/maltodextrin ABC transporter, permease protein MalF locus|SACOL0194, protein_id|YP_185093.1, gi|57651210, geneID|3236254
194 229058 229897 840 + 1         Maltodextrin ABC transporter, permease protein MdxG locus|SACOL0195, protein_id|YP_185094.1, gi|57651211, geneID|3236255
195 229971 231047 1077 + 73         Myo-inositol 2-dehydrogenase 1 (EC 1.1.1.18) locus|SACOL0196, protein_id|YP_185095.1, gi|57651212, geneID|3236256

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93062.19.peg.190 M23/M37 peptidase domain protein
MTKRPKRILATIIIFLSLLFTIIYIDDIQKWFNQYTDKLTQNHKGQGHSKWEDFFRGSRI
TETFGKYQHSPFDGKHYGIDFALPKGTPIKAPTNGKVTRIFNNELGGKVLQIAEDNGEYH
QWYLHLDKYNVKVGDRVKAGDIIAYSGNTGIQTTGAHLHFQRMKGGVGNAYAEDPKPFID
QLPDGERSLYDL

MD5 = f6939981c1e2051af7261a1ee5580c2b


  DNA Sequence

>fig|93062.19.peg.190 M23/M37 peptidase domain protein
atgacaaagcgaccaaaacgtattttggcaacaattatcatttttctttcactattattt
acgattatttatatagatgacattcaaaaatggtttaaccaatataccgataaattgaca
caaaatcataaaggacaaggacactcaaaatgggaagacttttttagagggagtcggatt
actgagacttttggtaaatatcaacattcaccatttgatggtaagcattatggcattgat
tttgcattgccaaaaggtacaccaattaaagcgccgacgaatggtaaagtaacacgtatc
tttaataatgaattgggcggcaaggtattacagattgccgaagacaatggagaatatcac
cagtggtatctacacttagacaaatataatgtcaaagtaggtgatcgagtcaaagcaggt
gatattattgcatattcaggcaatacaggtatacaaacgacaggcgcacatttacatttt
caaagaatgaagggtggcgtaggtaatgcatatgcagaagatccaaaaccgtttatcgat
cagttacctgatggggaacgtagcctatatgatttgtag


  DNA with Flanking Sequence

>fig|93062.19.peg.190 M23/M37 peptidase domain protein
gcgttacaaatacatatttatctgcacttaaaaattcttctaaaatgtcactcaatcttg
aaactttcatttgttcatcatcagttaacgtttcgccattactcatttttccccaaccag
ttaatacatctttgtcaataactggaatataagtttcaaataaatcaatatgtttcactt
catcatcaggatgttgttgttgatatgtttcgataaatgctttaccagccgccatagaat
ttgataccagttcattaaaagggtgtgctgtaatatataatacttttgccatttgaaaat
tctcctctgtttctgttattttcttaagtataattattatactcgatataaaatttaata
tcaatcaaaatattcaaattaccatcattttcttcatctatatttggcagtactactaaa
gtatgagtgcatttaattatgaaatagttgatttagaatatatacttaatacccaaaata
tatgaaggatggatgccactatgacaaagcgaccaaaacgtattttggcaacaattatca
tttttctttcactattatttacgattatttatatagatgacattcaaaaatggtttaacc
aatataccgataaattgacacaaaatcataaaggacaaggacactcaaaatgggaagact
tttttagagggagtcggattactgagacttttggtaaatatcaacattcaccatttgatg
gtaagcattatggcattgattttgcattgccaaaaggtacaccaattaaagcgccgacga
atggtaaagtaacacgtatctttaataatgaattgggcggcaaggtattacagattgccg
aagacaatggagaatatcaccagtggtatctacacttagacaaatataatgtcaaagtag
gtgatcgagtcaaagcaggtgatattattgcatattcaggcaatacaggtatacaaacga
caggcgcacatttacattttcaaagaatgaagggtggcgtaggtaatgcatatgcagaag
atccaaaaccgtttatcgatcagttacctgatggggaacgtagcctatatgatttgtagt
tatagaagggtgcccgcagtctaaaaaattaagcaatcattgtgtgagtatgatacttac
ataatggttgcttttttcaatgaaaatcgtaatgctaagtcatacttgtttgatttagat
attacttaaaatgtaagacaaggttgttagcattggcagtgaaatatcgcacataaaaaa
cattattgtcacactagaaaatagttgtgcactatatcaattttctgtataaaagtttaa
ttctgacagtaatgtaaacgtttataatttatgattgacattaataatgactgaatatat
gatttatgtaagtatttgtgcaaacgttttcacaaagtgtattgcacaatcaaactgtaa
acaaagtatgggaggcataacatggcagaactaaagttagagcatattaaaaagacgtat
gataacaacaatactgtagtgaaagattttaatctacatattactgacaaagaattcatt
gtatttgttggaccatcgg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004222       F:metalloendopeptidase activity
GO:0006508       P:proteolysis
cmr|NT05SA0156 Staphylococcus aureus NCTC 8325     M23/M37 peptidase domain protein
cmr|SACOL0191 Staphylococcus aureus subsp. aureus COL     M23/M37 peptidase domain protein
cmr|SAUSA300_0207 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAF66422.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.1666 Staphylococcus aureus subsp. aureus USA300 FIG   M23/M37 peptidase domain protein
fig|426430.6.peg.149 Staphylococcus aureus subsp. aureus str. Newman FIG   M23/M37 peptidase domain protein
fig|426430.8.peg.160 Staphylococcus aureus subsp. aureus str. Newman FIG   M23/M37 peptidase domain protein
fig|451515.3.peg.267 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   M23/M37 peptidase domain protein
fig|451516.9.peg.257 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   M23/M37 peptidase domain protein
fig|452948.4.peg.60 Staphylococcus aureus 930918-3 FIG   M23/M37 peptidase domain protein
fig|455227.3.peg.221 Staphylococcus aureus D30 FIG   M23/M37 peptidase domain protein
fig|553567.3.peg.1133 Staphylococcus aureus A5948 FIG   M23/M37 peptidase domain protein
fig|553590.4.peg.1210 Staphylococcus aureus A9754 FIG   M23/M37 peptidase domain protein
fig|553594.3.peg.869 Staphylococcus aureus A9765 FIG   M23/M37 peptidase domain protein
fig|644279.4.peg.278 Staphylococcus aureus subsp. aureus 132 FIG   M23/M37 peptidase domain protein
fig|93061.3.peg.185 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   M23/M37 peptidase domain protein
fig|93061.5.peg.162 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   M23/M37 peptidase domain protein
fig|93062.4.peg.657 Staphylococcus aureus subsp. aureus COL FIG   M23/M37 peptidase domain protein
gb|AAW37487.1 Staphylococcus aureus subsp. aureus COL     M23/M37 peptidase domain protein
gb|ABD21707.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD29352.1 Staphylococcus aureus subsp. aureus NCTC 8325     M23/M37 peptidase domain protein
gb|EEV83513.1 Staphylococcus aureus A5948     M23/M37 peptidase domain-containing protein
gb|EEW46001.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0660
gb|EEW48158.1 Staphylococcus aureus D30     hypothetical protein SAD30_1713
gi|150373162 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151220362 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0150
gi|257860691 Staphylococcus aureus A5948 NCBI   M23/M37 peptidase domain-containing protein
gi|258451643 Staphylococcus aureus A5948 NCBI   M23/M37 peptidase domain-containing protein
gi|259160982 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0660
gi|259163602 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1713
gi|57285393 Staphylococcus aureus subsp. aureus COL NCBI   M23/M37 peptidase domain protein
gi|57651207 Staphylococcus aureus subsp. aureus COL NCBI   M23/M37 peptidase domain-containing protein
gi|87127193 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87161219 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0207
gi|87201542 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   M23/M37 peptidase domain protein
gi|88193984 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   M23/M37 peptidase domain-containing protein
img|637150973 Staphylococcus aureus aureus COL IMG   M23/M37 peptidase domain protein
img|637886862 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637892845 Staphylococcus aureus aureus NCTC 8325 IMG   M23/M37 peptidase domain protein
img|640794510 Staphylococcus aureus aureus Newman IMG   hypothetical protein
kegg|saa:SAUSA300_0207 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL0191 Staphylococcus aureus subsp. aureus COL KEGG   M23/M37 peptidase domain-containing protein
kegg|sae:NWMN_0150 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_00174 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   M23/M37 peptidase domain-containing protein
ref|YP_001331185.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0150
ref|YP_185090.1 Staphylococcus aureus subsp. aureus COL RefSeq   M23/M37 peptidase domain-containing protein
ref|YP_492921.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0207
ref|YP_498771.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   M23/M37 peptidase domain-containing protein
ref|ZP_05699669.1 Staphylococcus aureus A5948 RefSeq   M23/M37 peptidase domain-containing protein
tr|A6QDJ0 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|Q2FK57 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2G1F1 Staphylococcus aureus (strain NCTC 8325) TrEMBL   M23/M37 peptidase domain protein
tr|Q5HJG7 Staphylococcus aureus (strain COL) TrEMBL   M23/M37 peptidase domain protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search