The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.1715: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Proline dipeptidase (EC 3.4.13.9)
Translate Function Assignments



Context on contig NC_002951 from base 1788617 to 1802351 (13735 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1710 1791814 1788617 3198 -       2: 8 1   DNA polymerase III alpha subunit (EC 2.7.7.7) gene_name|dnaE, locus|SACOL1750, protein_id|YP_186586.1, gi|57650573, geneID|3238132
1711 1792776 1791835 942 - 20     3: 10 1 4   FIG146085: 3'-to-5' oligoribonuclease A, Bacillus type locus|SACOL1751, protein_id|YP_186587.1, gi|57650574, geneID|3238462
1712 1794335 1793037 1299 - 260     1: 1   Uncharacterized protein YtoI locus|SACOL1752, protein_id|YP_186588.1, gi|57652003, geneID|3236730
1713 1794540 1794953 414 + 204     2: 3 1   Universal stress protein family locus|SACOL1753, protein_id|YP_186589.1, gi|57652004, geneID|3235990
1714 1795946 1795344 603 - 390     1: 1   FIG002379: metal-dependent hydrolase  
1715 1796121 1797176 1056 + 174     1: 1   Proline dipeptidase (EC 3.4.13.9) gene_name|pepQ, locus|SACOL1756, protein_id|YP_186590.1, gi|57652005, geneID|3235992
1716 1798610 1797492 1119 - 315     2: 7 1   Alanine dehydrogenase (EC 1.4.1.1) gene_name|ald2, locus|SACOL1758, protein_id|YP_186592.1, gi|57652007, geneID|3235994
1717 1798751 1799251 501 + 140     2: 3 1   Universal stress protein family locus|SACOL1759, protein_id|YP_186593.1, gi|57652008, geneID|3235995
1718 1800699 1799497 1203 - 245     6: 6 5 12 13 14 2   Acetate kinase (EC 2.7.2.1) gene_name|ackA, locus|SACOL1760, protein_id|YP_186594.1, gi|57652009, geneID|3236755
1719 1801734 1800787 948 - 87     2: 11 2   Adenine-specific methyltransferase (EC 2.1.1.72) locus|SACOL1761, protein_id|YP_186595.1, gi|57652010, geneID|3236756
1720 1802351 1801857 495 - 122     2: 9 2   Thiol peroxidase, Tpx-type (EC 1.11.1.15) gene_name|tpx, locus|SACOL1762, protein_id|YP_186596.1, gi|57652011, geneID|3236757

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CBSS-269801.1.peg.809 RossO Proline dipeptidase (EC 3.4.13.9)


  Protein Sequence

>fig|93062.19.peg.1715 Proline dipeptidase (EC 3.4.13.9)
MTKISKIIDELNNQQADAAWITTPLNVYYFTGYRSEPHERLFALLIKKDGKQVLFCPKME
VEEVKASPFTGEIVGYLDTENPFSLYPQTINKLLIESEHLTVARQKQLISGFNVNSFGDV
DLTIKQLRNIKSEDEISKIRKAAELADKCIEIGVSYLKEGVTECEVVNHIEQTIKQYGVN
EMSFDTMVLFGDHAASPHGTPGDRRLKSNEYVLFDLGVIYEHYCSDMTRTIKFGEPSKEA
QEIYNIVLEAETSAIQAIKPGIPLKDIDHIARNIISEKGYGEYFPHRLGHGLGLQEHEYQ
DVSSTNSNLLEAGMVITIEPGIYVPGVAGVRIEDDILVTNEGYEVLTHYEK

MD5 = 61224401020ae41687f4d7b29a4a1740


  DNA Sequence

>fig|93062.19.peg.1715 Proline dipeptidase (EC 3.4.13.9)
atgacaaaaatatcaaaaataatagacgaattgaacaatcaacaagctgatgcagcatgg
attacaacaccgttgaatgtatattattttactggataccgtagcgaaccccatgaaaga
ttatttgcattattgattaagaaagatggtaaacaagtactattttgtccaaaaatggaa
gtcgaagaagtcaaagcatcacctttcacaggtgaaatcgttggatatttagacactgaa
aaccctttttcactttatcctcaaacaatcaataaattactaattgaaagcgagcactta
acagtagcacgccaaaaacaattaatctctggtttcaatgtcaattcattcggagatgtt
gatttaacaatcaaacaattgagaaatattaaatccgaagatgaaattagcaaaatacgt
aaagctgctgagttagcagataagtgtatcgaaataggtgtttcttatttaaaagaaggt
gtgactgaatgtgaagtagtcaaccatattgagcaaactatcaaacaatatggcgtcaat
gaaatgagttttgatacgatggttttatttggagatcatgccgcatcacctcatggcaca
ccaggagatcgcagattaaaaagcaatgaatatgtactatttgatttaggtgtaatttat
gagcattattgtagcgatatgacacgtactattaaatttggtgaacctagcaaagaagca
caagaaatttataatattgtattagaagcagaaacatctgcaatccaagcaattaaacct
ggaataccattaaaagatatcgatcatatcgctagaaatattatttcagaaaaaggttat
ggtgaatatttccctcatcgcttaggtcatggcctaggattacaagaacatgaatatcaa
gatgtttcaagtactaattctaatttgttagaagctggcatggttattacaatcgaacca
ggtatttatgtacctggtgttgcaggtgtaagaattgaagatgacatacttgtcactaat
gaaggatatgaagtattaacacattacgaaaaataa


  DNA with Flanking Sequence

>fig|93062.19.peg.1715 Proline dipeptidase (EC 3.4.13.9)
aatgcttgaacaaatttaacgcttccgaaatcaaagtttgctttaccaccaatattcata
ccatgaacattttcaacaccgtgatatgaagaaagatagtcagccatttctgcacttcca
attactgttgctcctgttttctttgctagttccacaacatcaccaaaatgatcaaaatga
ccgtgcgttaaaacgatatagtctacctgcactgtttcaatattcaaatcacacttaggg
ttatttgaaataaacggatctacgataacctttttgttgttcccttctaaataaatcgtt
gattgaccatgaaatgataacttcatttgagcatcctcctatcaattactatataaattt
agtacccttttgccacttaattataacaaattctcaaattttaaaaattgaaaatctagt
taatgtattagctcgattttgaaatctaataataattggcataaaatggaagtaatatta
tgttgaggagtgtttataaaatgacaaaaatatcaaaaataatagacgaattgaacaatc
aacaagctgatgcagcatggattacaacaccgttgaatgtatattattttactggatacc
gtagcgaaccccatgaaagattatttgcattattgattaagaaagatggtaaacaagtac
tattttgtccaaaaatggaagtcgaagaagtcaaagcatcacctttcacaggtgaaatcg
ttggatatttagacactgaaaaccctttttcactttatcctcaaacaatcaataaattac
taattgaaagcgagcacttaacagtagcacgccaaaaacaattaatctctggtttcaatg
tcaattcattcggagatgttgatttaacaatcaaacaattgagaaatattaaatccgaag
atgaaattagcaaaatacgtaaagctgctgagttagcagataagtgtatcgaaataggtg
tttcttatttaaaagaaggtgtgactgaatgtgaagtagtcaaccatattgagcaaacta
tcaaacaatatggcgtcaatgaaatgagttttgatacgatggttttatttggagatcatg
ccgcatcacctcatggcacaccaggagatcgcagattaaaaagcaatgaatatgtactat
ttgatttaggtgtaatttatgagcattattgtagcgatatgacacgtactattaaatttg
gtgaacctagcaaagaagcacaagaaatttataatattgtattagaagcagaaacatctg
caatccaagcaattaaacctggaataccattaaaagatatcgatcatatcgctagaaata
ttatttcagaaaaaggttatggtgaatatttccctcatcgcttaggtcatggcctaggat
tacaagaacatgaatatcaagatgtttcaagtactaattctaatttgttagaagctggca
tggttattacaatcgaaccaggtatttatgtacctggtgttgcaggtgtaagaattgaag
atgacatacttgtcactaatgaaggatatgaagtattaacacattacgaaaaataaggag
tgggataaaaatgaaaagcttgttacaagcgcattctcattcagtcaaacactgccaata
taacattgtagcgcctaagacataaatttttatccaagtctaaatgcaatatgtaacaaa
caagctagaaacacatatgcaggtatgttcatcagtaacatgtaatgaatcaaatcaata
tcattcatgttcgatgatttcttcgcattgtttctagctttaatttatcattatttaatt
ttaataaccaaggagatgataacgtcattctttagtacgctgtaatccattcccttttca
tcaaattcaaattataattgtaatgcttcttctacagatttatattccatttcaaatgcc
tctgcaacgcctttattggttacgtgacctttgtaagtatttaaacctaatgataatggt
tgatttgatttaaatgcttctctataccctttattagctagcatgagcgcataaggtagc
gtagcattatttaaag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0006508       P:proteolysis
GO:0008235       F:metalloexopeptidase activity
GO:0009987       P:cellular process
GO:0016805       F:dipeptidase activity
GO:0030145       F:manganese ion binding
cmr|NT05SA1618 Staphylococcus aureus NCTC 8325     Xaa-Pro dipeptidase
cmr|SACOL1756 Staphylococcus aureus subsp. aureus COL     proline dipeptidase
cmr|SAUSA300_1654 Staphylococcus aureus subsp. aureus USA300-FPR3757     proline dipeptidase
dbj|BAF67874.1 Staphylococcus aureus subsp. aureus str. Newman     proline dipeptidase homolog
fig|367830.3.peg.997 Staphylococcus aureus subsp. aureus USA300 FIG   Proline dipeptidase (EC 3.4.13.9)
fig|426430.8.peg.1734 Staphylococcus aureus subsp. aureus str. Newman FIG   Proline dipeptidase (EC 3.4.13.9)
fig|451515.3.peg.1805 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Proline dipeptidase (EC 3.4.13.9)
fig|451516.9.peg.1794 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Proline dipeptidase (EC 3.4.13.9)
fig|452948.4.peg.846 Staphylococcus aureus 930918-3 FIG   Proline dipeptidase (EC 3.4.13.9)
fig|455227.3.peg.1066 Staphylococcus aureus D30 FIG   Proline dipeptidase (EC 3.4.13.9)
fig|546342.3.peg.926 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Proline dipeptidase (EC 3.4.13.9)
fig|546343.3.peg.2404 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Proline dipeptidase (EC 3.4.13.9)
fig|553567.3.peg.388 Staphylococcus aureus A5948 FIG   Proline dipeptidase (EC 3.4.13.9)
fig|553590.4.peg.1929 Staphylococcus aureus A9754 FIG   Proline dipeptidase (EC 3.4.13.9)
fig|553594.3.peg.1804 Staphylococcus aureus A9765 FIG   Proline dipeptidase (EC 3.4.13.9)
fig|644279.4.peg.1853 Staphylococcus aureus subsp. aureus 132 FIG   Proline dipeptidase (EC 3.4.13.9)
fig|93061.3.peg.1650 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Proline dipeptidase (EC 3.4.13.9)
fig|93061.5.peg.1656 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Proline dipeptidase (EC 3.4.13.9)
fig|93062.4.peg.423 Staphylococcus aureus subsp. aureus COL FIG   Proline dipeptidase (EC 3.4.13.9)
gb|AAW38285.1 Staphylococcus aureus subsp. aureus COL     proline dipeptidase
gb|ABD20725.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     proline dipeptidase
gb|ABD30884.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX29701.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     M24 family Xaa-Pro dipeptidase
gi|123003454 organism not parsed/found in ncbi nr NCBI   RecName: Full=Uncharacterized peptidase SAOUHSC_01816
gi|123749603 organism not parsed/found in ncbi nr NCBI   RecName: Full=Uncharacterized peptidase SAUSA300_1654
gi|150374614 Staphylococcus aureus subsp. aureus str. Newman NCBI   proline dipeptidase homolog
gi|151221814 Staphylococcus aureus subsp. aureus str. Newman NCBI   proline dipeptidase-like protein
gi|160368730 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   M24 family Xaa-Pro dipeptidase
gi|161509921 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   M24 family Xaa-Pro dipeptidase
gi|221137939 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   M24 family Xaa-Pro dipeptidase
gi|221142343 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   M24 family Xaa-Pro dipeptidase
gi|57286191 Staphylococcus aureus subsp. aureus COL NCBI   proline dipeptidase
gi|57652005 Staphylococcus aureus subsp. aureus COL NCBI   proline dipeptidase
gi|81694306 organism not parsed/found in ncbi nr NCBI   RecName: Full=Uncharacterized peptidase SACOL1756
gi|87126211 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   proline dipeptidase
gi|87160237 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   proline dipeptidase
gi|87203074 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88195516 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01816
img|637152490 Staphylococcus aureus aureus COL IMG   proline dipeptidase( EC:3.4.13.9 )
img|637888303 Staphylococcus aureus aureus USA300 IMG   proline dipeptidase( EC:3.4.13.9 )
img|637894415 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640795983 Staphylococcus aureus aureus Newman IMG   proline dipeptidase homolog
img|641309654 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   M24 family Xaa-Pro dipeptidase( EC:3.4.13.9 )
kegg|saa:SAUSA300_1654 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   proline dipeptidase (EC:3.4.13.9)
kegg|sac:SACOL1756 Staphylococcus aureus subsp. aureus COL KEGG   proline dipeptidase (EC:3.4.13.9)
kegg|sae:NWMN_1602 Staphylococcus aureus subsp. aureus Newman KEGG   proline dipeptidase-like protein
kegg|sao:SAOUHSC_01816 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_1694 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   M24 family Xaa-Pro dipeptidase (EC:3.4.13.9)
ref|YP_001332636.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   proline dipeptidase-like protein
ref|YP_001575580.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   M24 family Xaa-Pro dipeptidase
ref|YP_186590.1 Staphylococcus aureus subsp. aureus COL RefSeq   proline dipeptidase
ref|YP_494348.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   proline dipeptidase
ref|YP_500321.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01816
ref|ZP_03562741.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   M24 family Xaa-Pro dipeptidase
ref|ZP_03566836.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   M24 family Xaa-Pro dipeptidase
sp|Q2FG30 Staphylococcus aureus (strain USA300) SwissProt   RecName: Full=Uncharacterized peptidase SAUSA300_1654
sp|Q2FXL9 Staphylococcus aureus (strain NCTC 8325) SwissProt   RecName: Full=Uncharacterized peptidase SAOUHSC_01816
sp|Q5HF67 Staphylococcus aureus (strain COL) SwissProt   RecName: Full=Uncharacterized peptidase SACOL1756
sp|Y1654_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Uncharacterized peptidase SAUSA300_1654
sp|Y1756_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Uncharacterized peptidase SACOL1756
sp|Y1816_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Uncharacterized peptidase SAOUHSC_01816
tr|A6QHP2 Staphylococcus aureus (strain Newman) TrEMBL   Proline dipeptidase homolog
tr|A8Z2M3 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   M24 family Xaa-Pro dipeptidase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search