The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.1581: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Undecaprenol kinase (EC 2.7.1.66)
Translate Function Assignments



Context on contig NC_002951 from base 1651649 to 1663596 (11948 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1575 1652467 1651649 819 -           ATP/GTP-binding protein, SA1392 homolog locus|SACOL1620, protein_id|YP_186460.1, gi|57651956, geneID|3238295
1576 1653017 1652478 540 - 10 4     CBS domain protein, lmo1865 homolog locus|SACOL1621, protein_id|YP_186461.1, gi|57651957, geneID|3238296
1577 1653436 1654827 1392 + 418     1: 12   Glycyl-tRNA synthetase (EC 6.1.1.14) gene_name|glyS, locus|SACOL1622, protein_id|YP_186462.1, gi|57651958, geneID|3238297
1578 1655723 1654977 747 - 149 9 2: 18 2   DNA recombination and repair protein RecO locus|SACOL1623, protein_id|YP_186463.1, gi|57651959, geneID|3238298
1579 1656650 1655751 900 - 27 13 6: 11 13 16 5 2 17   GTP-binding protein Era gene_name|era, locus|SACOL1624, protein_id|YP_186464.1, gi|57651960, geneID|3238299
1580 1657055 1656651 405 - 0 11 3: 10 7 15   Cytidine deaminase (EC 3.5.4.5) gene_name|cdd, locus|SACOL1625, protein_id|YP_186465.1, gi|57651961, geneID|3238300
1581 1657410 1657066 345 - 10   1: 14   Undecaprenol kinase (EC 2.7.1.66) gene_name|dgkA, locus|SACOL1626, protein_id|YP_186466.1, gi|57651962, geneID|3238273
1582 1657880 1657413 468 - 2 28 1: 1   Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly locus|SACOL1627, protein_id|YP_186467.1, gi|57651963, geneID|3238274
1583 1658828 1657881 948 - 0 15 3: 4 1 3   PhoH-like protein, PhoL locus|SACOL1628, protein_id|YP_186468.1, gi|57651964, geneID|3238275
1584 1659830 1659132 699 - 303         Uncharacterized membrane anchored protein YqfB locus|SACOL1629, protein_id|YP_186469.1, gi|57651965, geneID|3238276
1585 1660836 1659847 990 - 16         YqfA family protein, associated with cytidine deaminase locus|SACOL1630, protein_id|YP_186470.1, gi|57651966, geneID|3238277
1586 1661561 1660854 708 - 17         Putative membrane-bound ClpP-class protease associated with aq_911 locus|SACOL1631, protein_id|YP_186471.1, gi|57651967, geneID|3238278
1587 1661957 1661781 177 - 219     2: 19 8   SSU ribosomal protein S21p gene_name|rpsU, locus|SACOL1632, protein_id|YP_186472.1, gi|57651968, geneID|3238013
1588 1663596 1662250 1347 - 292     3: 3 6 9   tRNA-t(6)A37 methylthiotransferase locus|SACOL1633, protein_id|YP_186473.1, gi|57651969, geneID|3238014

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Glycerolipid_and_Glycerophospholipid_Metabolism_in_Bacteria OlgaZ Diacylglycerol kinase (EC 2.7.1.107)


  Protein Sequence

>fig|93062.19.peg.1581 Undecaprenol kinase (EC 2.7.1.66)
MKRFKYALDGLKILIQKDYKFLLHVFAMIVAIVFGLVLNINRIEWIFILIAIALVLTVEA
LNTAIEYVVDLVTVEYHDLAKYAKDIAAFSVLIVSILAFIIGLIVFLPHFIALF

MD5 = e62356b6d55063890265393fda8bb509


  DNA Sequence

>fig|93062.19.peg.1581 Undecaprenol kinase (EC 2.7.1.66)
atgaaaaggtttaaatatgcacttgatgggctgaaaatcttaattcaaaaagactataaa
tttcttttacatgtgtttgcaatgattgttgctattgtctttggtctcgtactaaatatt
aatcggattgagtggatatttatactcattgctattgcattagttctcactgttgaagct
ttaaacactgctattgaatatgttgtcgatttagtgaccgttgaatatcatgatttagct
aaatacgctaaagatattgcggcttttagtgtacttatagtttcaatattagcatttatt
ataggtttaatagtatttttaccacattttatagcgttattttag


  DNA with Flanking Sequence

>fig|93062.19.peg.1581 Undecaprenol kinase (EC 2.7.1.66)
atcattgaacattatgaaggagagaattaaatgtttacgatagattttagcgatcacaca
ggcttagttaaagatgcttggtataaacaaattgaagatttattagaatttgctaaaaaa
gaagagcatatagaagacgatgctgagctttctgttacatttgtagataaacaagaaata
caagaaattaatcgaacatatagagataaagataaagttacagatgtaatctcatttgct
ttagaagaagatgagccagagattgattttagtggtcttgatataccacgtgttttaggg
gatataattatctgtacggatgtagcgcaagaacaagcaaacaattacggacattctttt
gaacgagaattaggatttttagcattacatggatttttgcatctattaggttatgatcat
atgactgaagcggatgaaaaggaaatgtttggtcgacaagatacaatattaaacgcatat
ggattaacacgagactaattatgaaaaggtttaaatatgcacttgatgggctgaaaatct
taattcaaaaagactataaatttcttttacatgtgtttgcaatgattgttgctattgtct
ttggtctcgtactaaatattaatcggattgagtggatatttatactcattgctattgcat
tagttctcactgttgaagctttaaacactgctattgaatatgttgtcgatttagtgaccg
ttgaatatcatgatttagctaaatacgctaaagatattgcggcttttagtgtacttatag
tttcaatattagcatttattataggtttaatagtatttttaccacattttatagcgttat
tttagggaggcatatatgagttatcaacctcattattttcaagaagttagaaaagcacaa
caagaatcatattcgccatacagtcaatttaaagtaggggcttatttaaaaacgaaagac
ggtagaactttttatggtaccaatgtagaaaatgcttcttatccattatcgatatgtgct
gaacgagctagtttggtatcggcaatttctcaaggatacagaccaggtgattttgaatca
ataactgtaaccgtagatgcagataaaccgtcatcaccttgtggtgcatgtcgtcaagtt
ttgaaggaattatgtgatgatgatatgcctgtgtatatgacaaatcataaaggagatatg
gttatgatgacagtcgcagagttactaccatttggattttcaggaaaggatttagaataa
atgacagaacataaatcaggatttgtttcaattataggtagaccaaatgtaggaaagtca
acatttgttaatagagtgatcggcc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004143       F:diacylglycerol kinase activity
GO:0008654       P:phospholipid biosynthetic process
GO:0016020       C:membrane
cmr|NT01SA1529 Staphylococcus aureus N315     diacylglycerol kinase
cmr|NT02SA1554 Staphylococcus aureus Mu50     diacylglycerol kinase
cmr|NT03SA1653 Staphylococcus aureus MW2     diacylglycerol kinase, putative
cmr|NT08SA1602 Staphylococcus aureus subsp. aureus MRSA252     diacylglycerol kinase
cmr|NT09SA1494 Staphylococcus aureus subsp. aureus MSSA476     diacylglycerol kinase
cmr|SACOL1626 Staphylococcus aureus subsp. aureus COL     diacylglycerol kinase
cmr|SAUSA300_1529 Staphylococcus aureus subsp. aureus USA300-FPR3757     diacylglycerol kinase
dbj|BAB42661.1 Staphylococcus aureus subsp. aureus N315     SA1398
dbj|BAB57731.1 Staphylococcus aureus subsp. aureus Mu50     similar to diacylglycerol kinase
dbj|BAB95386.1 Staphylococcus aureus subsp. aureus MW2     MW1521
dbj|BAF67744.1 Staphylococcus aureus subsp. aureus str. Newman     diacylglycerol kinase
dbj|BAF78439.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
emb|CAG40641.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   putative diacylglycerol kinase
emb|CAG43308.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative diacylglycerol kinase
fig|158878.1.peg.1569 Staphylococcus aureus subsp. aureus Mu50 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|158878.14.peg.1615 Staphylococcus aureus subsp. aureus Mu50 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|158879.1.peg.1444 Staphylococcus aureus subsp. aureus N315 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|158879.11.peg.1504 Staphylococcus aureus subsp. aureus N315 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|196620.1.peg.1521 Staphylococcus aureus subsp. aureus MW2 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|196620.5.peg.1587 Staphylococcus aureus subsp. aureus MW2 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|282458.1.peg.1559 Staphylococcus aureus subsp. aureus MRSA252 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|282458.4.peg.1650 Staphylococcus aureus subsp. aureus MRSA252 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|282459.1.peg.1492 Staphylococcus aureus subsp. aureus MSSA476 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|282459.5.peg.1567 Staphylococcus aureus subsp. aureus MSSA476 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|359786.3.peg.290 Staphylococcus aureus subsp. aureus JH9 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|359787.11.peg.1695 Staphylococcus aureus subsp. aureus JH1 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|359787.3.peg.1504 Staphylococcus aureus subsp. aureus JH1 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|367830.3.peg.146 Staphylococcus aureus subsp. aureus USA300 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|418127.6.peg.1593 Staphylococcus aureus subsp. aureus Mu3 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|426430.8.peg.1600 Staphylococcus aureus subsp. aureus str. Newman FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|451515.3.peg.1670 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|451516.9.peg.1660 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|452948.4.peg.208 Staphylococcus aureus 930918-3 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|505321.3.peg.1559 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|546342.3.peg.860 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|546343.3.peg.15 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|548470.3.peg.2368 Staphylococcus aureus subsp. aureus MN8 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|548473.3.peg.1705 Staphylococcus aureus subsp. aureus TCH60 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|548474.3.peg.741 Staphylococcus aureus subsp. aureus TCH130 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|548475.3.peg.558 Staphylococcus aureus subsp. aureus TCH70 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|553565.3.peg.267 Staphylococcus aureus A5937 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|553568.3.peg.1045 Staphylococcus aureus A6224 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|553571.3.peg.1850 Staphylococcus aureus A6300 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|553573.3.peg.1399 Staphylococcus aureus A8115 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|553574.3.peg.413 Staphylococcus aureus A8117 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|553577.3.peg.1796 Staphylococcus aureus A8796 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|553580.3.peg.1830 Staphylococcus aureus A8819 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|553581.3.peg.1437 Staphylococcus aureus A9299 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|553588.3.peg.464 Staphylococcus aureus A9719 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|553590.4.peg.657 Staphylococcus aureus A9754 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|553592.3.peg.1366 Staphylococcus aureus A9763 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|553596.3.peg.500 Staphylococcus aureus A9781 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|585143.3.peg.2103 Staphylococcus aureus subsp. aureus 55/2053 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|585144.3.peg.2129 Staphylococcus aureus subsp. aureus 58-424 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|585145.3.peg.1832 Staphylococcus aureus subsp. aureus 65-1322 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|585146.3.peg.2101 Staphylococcus aureus subsp. aureus 68-397 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|585147.3.peg.1175 Staphylococcus aureus subsp. aureus A017934/97 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|585149.6.peg.1740 Staphylococcus aureus subsp. aureus C101 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|585151.3.peg.786 Staphylococcus aureus subsp. aureus C427 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|585152.3.peg.1560 Staphylococcus aureus subsp. aureus D139 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|585153.3.peg.1847 Staphylococcus aureus subsp. aureus E1410 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|585154.3.peg.1268 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|585155.3.peg.1788 Staphylococcus aureus subsp. aureus H19 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|585156.3.peg.1121 Staphylococcus aureus subsp. aureus M1015 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|585157.3.peg.1300 Staphylococcus aureus subsp. aureus M809 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|585158.3.peg.2088 Staphylococcus aureus subsp. aureus M876 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|585159.3.peg.1644 Staphylococcus aureus subsp. aureus M899 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|585160.3.peg.1109 Staphylococcus aureus subsp. aureus WBG10049 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|585161.3.peg.1288 Staphylococcus aureus subsp. aureus WW2703/97 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|585891.3.peg.1612 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|680649.3.peg.1158 Staphylococcus aureus subsp. aureus MR1 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|681288.4.peg.1559 Staphylococcus aureus subsp. aureus ED98 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|703339.3.peg.1554 Staphylococcus aureus 04-02981 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|762962.3.peg.417 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|93061.3.peg.1618 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|93061.5.peg.1520 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Undecaprenol kinase (EC 2.7.1.66)
fig|93062.4.peg.1327 Staphylococcus aureus subsp. aureus COL FIG   Undecaprenol kinase (EC 2.7.1.66)
gb|AAW38242.1 Staphylococcus aureus subsp. aureus COL     diacylglycerol kinase
gb|ABD21023.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     diacylglycerol kinase
gb|ABD30746.1 Staphylococcus aureus subsp. aureus NCTC 8325     diacylglycerol kinase, putative
gb|ABQ49420.1 Staphylococcus aureus subsp. aureus JH9     diacylglycerol kinase
gb|ABR52509.1 Staphylococcus aureus subsp. aureus JH1     diacylglycerol kinase
gb|ABX29577.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     diacylglycerol kinase
gb|EEI95658.1 Staphylococcus aureus subsp. aureus MN8     diacylglycerol kinase
gb|EEJ61677.1 Staphylococcus aureus subsp. aureus TCH60     diacylglycerol kinase
gb|EES54670.1 Staphylococcus aureus subsp. aureus TCH70     diacylglycerol kinase
gb|EES97450.1 Staphylococcus aureus subsp. aureus TCH130     diacylglycerol kinase
gb|EEV03534.1 Staphylococcus aureus subsp. aureus 55/2053     diacylglycerol kinase
gb|EEV06683.1 Staphylococcus aureus subsp. aureus 65-1322     diacylglycerol kinase
gb|EEV09058.1 Staphylococcus aureus subsp. aureus 68-397     diacylglycerol kinase
gb|EEV11910.1 Staphylococcus aureus subsp. aureus E1410     diacylglycerol kinase
gb|EEV14068.1 Staphylococcus aureus subsp. aureus M876     diacylglycerol kinase
gb|EEV25957.1 Staphylococcus aureus A9781     diacylglycerol kinase
gb|EEV64669.1 Staphylococcus aureus A9763     diacylglycerol kinase
gb|EEV68246.1 Staphylococcus aureus A9719     diacylglycerol kinase
gb|EEV69650.1 Staphylococcus aureus A9635     diacylglycerol kinase
gb|EEV72594.1 Staphylococcus aureus A9299     diacylglycerol kinase
gb|EEV74956.1 Staphylococcus aureus A8115     diacylglycerol kinase
gb|EEV77338.1 Staphylococcus aureus A6300     diacylglycerol kinase
gb|EEV80895.1 Staphylococcus aureus A6224     diacylglycerol kinase
gb|EEV84559.1 Staphylococcus aureus A5948     diacylglycerol kinase
gb|EEV87026.1 Staphylococcus aureus A5937     diacylglycerol kinase
gb|EEW45886.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1660
gb|EEW47377.1 Staphylococcus aureus D30     hypothetical protein SAD30_0300
gi|13701367 Staphylococcus aureus subsp. aureus N315 NCBI   SA1398
gi|14247340 Staphylococcus aureus subsp. aureus Mu50 NCBI   similar to diacylglycerol kinase
gi|147741122 Staphylococcus aureus subsp. aureus JH9 NCBI   diacylglycerol kinase
gi|148268053 Staphylococcus aureus subsp. aureus JH9 NCBI   diacylglycerol kinase
gi|149946573 Staphylococcus aureus subsp. aureus JH1 NCBI   diacylglycerol kinase
gi|150374484 Staphylococcus aureus subsp. aureus str. Newman NCBI   diacylglycerol kinase
gi|150394121 Staphylococcus aureus subsp. aureus JH1 NCBI   diacylglycerol kinase
gi|151221684 Staphylococcus aureus subsp. aureus str. Newman NCBI   diacylglycerol kinase
gi|156722022 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156979887 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_1556
gi|15924559 Staphylococcus aureus subsp. aureus Mu50 NCBI   diacylglycerol kinase
gi|15927149 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA1398
gi|160368606 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   diacylglycerol kinase
gi|161509797 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   diacylglycerol kinase
gi|21204690 Staphylococcus aureus subsp. aureus MW2 NCBI   MW1521
gi|21283250 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW1521
gi|221137875 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   diacylglycerol kinase
gi|221140011 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   diacylglycerol kinase
gi|227245899 Staphylococcus aureus subsp. aureus MN8 NCBI   diacylglycerol kinase
gi|227557767 Staphylococcus aureus subsp. aureus MN8 NCBI   diacylglycerol kinase
gi|227851879 Staphylococcus aureus subsp. aureus TCH60 NCBI   diacylglycerol kinase
gi|227899919 Staphylococcus aureus subsp. aureus TCH60 NCBI   diacylglycerol kinase
gi|251802013 Staphylococcus aureus subsp. aureus TCH70 NCBI   diacylglycerol kinase
gi|251814565 Staphylococcus aureus subsp. aureus TCH70 NCBI   diacylglycerol kinase
gi|253316044 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   diacylglycerol kinase
gi|253728721 Staphylococcus aureus subsp. aureus TCH130 NCBI   diacylglycerol kinase
gi|253733181 Staphylococcus aureus subsp. aureus TCH130 NCBI   diacylglycerol kinase
gi|255006355 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   diacylglycerol kinase
gi|257271388 Staphylococcus aureus subsp. aureus 55/2053 NCBI   diacylglycerol kinase
gi|257275196 Staphylococcus aureus subsp. aureus 65-1322 NCBI   diacylglycerol kinase
gi|257278422 Staphylococcus aureus subsp. aureus 68-397 NCBI   diacylglycerol kinase
gi|257281773 Staphylococcus aureus subsp. aureus E1410 NCBI   diacylglycerol kinase
gi|257283945 Staphylococcus aureus subsp. aureus M876 NCBI   diacylglycerol kinase
gi|257425694 Staphylococcus aureus subsp. aureus 55/2053 NCBI   diacylglycerol kinase
gi|257428355 Staphylococcus aureus subsp. aureus 65-1322 NCBI   diacylglycerol kinase
gi|257430992 Staphylococcus aureus subsp. aureus 68-397 NCBI   diacylglycerol kinase
gi|257433680 Staphylococcus aureus subsp. aureus E1410 NCBI   diacylglycerol kinase
gi|257436594 Staphylococcus aureus subsp. aureus M876 NCBI   diacylglycerol kinase
gi|257787617 Staphylococcus aureus A9781 NCBI   diacylglycerol kinase
gi|257793645 Staphylococcus aureus A9781 NCBI   diacylglycerol kinase
gi|257840205 Staphylococcus aureus A9763 NCBI   diacylglycerol kinase
gi|257843852 Staphylococcus aureus A9719 NCBI   diacylglycerol kinase
gi|257845618 Staphylococcus aureus A9635 NCBI   diacylglycerol kinase
gi|257848606 Staphylococcus aureus A9299 NCBI   diacylglycerol kinase
gi|257851013 Staphylococcus aureus A8115 NCBI   diacylglycerol kinase
gi|257854389 Staphylococcus aureus A6300 NCBI   diacylglycerol kinase
gi|257858006 Staphylococcus aureus A6224 NCBI   diacylglycerol kinase
gi|257861760 Staphylococcus aureus A5948 NCBI   diacylglycerol kinase
gi|257864276 Staphylococcus aureus A5937 NCBI   diacylglycerol kinase
gi|258411055 Staphylococcus aureus A9763 NCBI   diacylglycerol kinase
gi|258420141 Staphylococcus aureus A9719 NCBI   diacylglycerol kinase
gi|258423997 Staphylococcus aureus A9635 NCBI   diacylglycerol kinase
gi|258437401 Staphylococcus aureus A9299 NCBI   diacylglycerol kinase
gi|258443607 Staphylococcus aureus A8115 NCBI   diacylglycerol kinase
gi|258446814 Staphylococcus aureus A6300 NCBI   diacylglycerol kinase
gi|258448728 Staphylococcus aureus A6224 NCBI   diacylglycerol kinase
gi|258450602 Staphylococcus aureus A5948 NCBI   diacylglycerol kinase
gi|258453545 Staphylococcus aureus A5937 NCBI   diacylglycerol kinase
gi|259160866 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1660
gi|259162812 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0300
gi|49241946 Staphylococcus aureus subsp. aureus MRSA252 NCBI   putative diacylglycerol kinase
gi|49244847 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative diacylglycerol kinase
gi|49483817 Staphylococcus aureus subsp. aureus MRSA252 NCBI   putative diacylglycerol kinase
gi|49486404 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative diacylglycerol kinase
gi|57286148 Staphylococcus aureus subsp. aureus COL NCBI   diacylglycerol kinase
gi|57651962 Staphylococcus aureus subsp. aureus COL NCBI   diacylglycerol kinase
gi|87126509 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   diacylglycerol kinase
gi|87160535 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   diacylglycerol kinase
gi|87202936 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   diacylglycerol kinase, putative
gi|88195378 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   diacylglycerol kinase, putative
img|637093064 Staphylococcus aureus aureus N315 IMG   hypothetical protein( EC:2.7.1.107 )
img|637100078 Staphylococcus aureus aureus Mu50 IMG   similar to diacylglycerol kinase( EC:2.7.1.107 )
img|637152366 Staphylococcus aureus aureus COL IMG   diacylglycerol kinase( EC:2.7.1.107 )
img|637155066 Staphylococcus aureus aureus MRSA252 IMG   putative diacylglycerol kinase( EC:2.7.1.107 )
img|637157729 Staphylococcus aureus aureus MSSA476 IMG   putative diacylglycerol kinase( EC:2.7.1.107 )
img|637299285 Staphylococcus aureus aureus MW2 IMG   hypothetical protein( EC:2.7.1.107 )
img|637888179 Staphylococcus aureus aureus USA300 IMG   diacylglycerol kinase( EC:2.7.1.107 )
img|637894276 Staphylococcus aureus aureus NCTC 8325 IMG   diacylglycerol kinase, putative( EC:2.7.1.107 )
img|639107765 Staphylococcus aureus aureus JH1 IMG   Prokaryotic diacylglycerol kinase( EC:2.7.1.107 )
img|640565973 Staphylococcus aureus aureus JH9 IMG   diacylglycerol kinase
img|640779743 Staphylococcus aureus aureus JH1 IMG   diacylglycerol kinase( EC:2.7.1.107 )
img|640795853 Staphylococcus aureus aureus Newman IMG   diacylglycerol kinase( EC:2.7.1.107 )
img|640904300 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein( EC:2.7.1.107 )
img|641309529 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   diacylglycerol kinase( EC:2.7.1.107 )
img|641772478 Staphylococcus aureus aureus USA300_TCH959 IMG   diacylglycerol kinase( EC:2.7.1.107 )
kegg|saa:SAUSA300_1529 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   diacylglycerol kinase (EC:2.7.1.107)
kegg|sac:SACOL1626 Staphylococcus aureus subsp. aureus COL KEGG   diacylglycerol kinase (EC:2.7.1.107)
kegg|sae:NWMN_1472 Staphylococcus aureus subsp. aureus Newman KEGG   diacylglycerol kinase
kegg|sah:SaurJH1_1661 Staphylococcus aureus subsp. aureus JH1 KEGG   diacylglycerol kinase
kegg|saj:SaurJH9_1627 Staphylococcus aureus subsp. aureus JH9 KEGG   diacylglycerol kinase
kegg|sam:MW1521 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_01671 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   diacylglycerol kinase, putative (EC:2.7.1.107)
kegg|sar:SAR1646   KEGG   putative diacylglycerol kinase
kegg|sas:SAS1507   KEGG   putative diacylglycerol kinase
kegg|sau:SA1398   KEGG   hypothetical protein
kegg|sav:SAV1569   KEGG   diacylglycerol kinase
kegg|saw:SAHV_1556 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_1570 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   diacylglycerol kinase (EC:2.7.1.107)
ref|NP_372093.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   diacylglycerol kinase
ref|NP_374682.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA1398
ref|NP_646338.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW1521
ref|YP_001246996.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   diacylglycerol kinase
ref|YP_001316796.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   diacylglycerol kinase
ref|YP_001332506.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   diacylglycerol kinase
ref|YP_001442146.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_1556
ref|YP_001575456.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   diacylglycerol kinase
ref|YP_041041.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   putative diacylglycerol kinase
ref|YP_043625.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   putative diacylglycerol kinase
ref|YP_186466.1 Staphylococcus aureus subsp. aureus COL RefSeq   diacylglycerol kinase
ref|YP_494224.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   diacylglycerol kinase
ref|YP_500182.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   diacylglycerol kinase, putative
ref|ZP_03562677.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   diacylglycerol kinase
ref|ZP_03564504.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   diacylglycerol kinase
ref|ZP_03987814.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   diacylglycerol kinase
ref|ZP_04017724.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   diacylglycerol kinase
ref|ZP_04829038.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   diacylglycerol kinase
ref|ZP_04839257.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   diacylglycerol kinase
ref|ZP_04867346.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   diacylglycerol kinase
ref|ZP_05144956.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   diacylglycerol kinase
ref|ZP_05602118.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   diacylglycerol kinase
ref|ZP_05604753.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   diacylglycerol kinase
ref|ZP_05607372.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   diacylglycerol kinase
ref|ZP_05610038.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   diacylglycerol kinase
ref|ZP_05612638.1 Staphylococcus aureus subsp. aureus M876 RefSeq   diacylglycerol kinase
ref|ZP_05642624.1 Staphylococcus aureus A9781 RefSeq   diacylglycerol kinase
ref|ZP_05681335.1 Staphylococcus aureus A9763 RefSeq   diacylglycerol kinase
ref|ZP_05683096.1 Staphylococcus aureus A9719 RefSeq   diacylglycerol kinase
ref|ZP_05686879.1 Staphylococcus aureus A9635 RefSeq   diacylglycerol kinase
ref|ZP_05689385.1 Staphylococcus aureus A9299 RefSeq   diacylglycerol kinase
ref|ZP_05691946.1 Staphylococcus aureus A8115 RefSeq   diacylglycerol kinase
ref|ZP_05694968.1 Staphylococcus aureus A6300 RefSeq   diacylglycerol kinase
ref|ZP_05696840.1 Staphylococcus aureus A6224 RefSeq   diacylglycerol kinase
ref|ZP_05698664.1 Staphylococcus aureus A5948 RefSeq   diacylglycerol kinase
ref|ZP_05701523.1 Staphylococcus aureus A5937 RefSeq   diacylglycerol kinase
tr|A5IT97 Staphylococcus aureus (strain JH9) TrEMBL   Diacylglycerol kinase
tr|A6QHB2 Staphylococcus aureus (strain Newman) TrEMBL   Diacylglycerol kinase
tr|A6U241 Staphylococcus aureus (strain JH1) TrEMBL   Diacylglycerol kinase
tr|A7X2W7 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8Z4A8 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Diacylglycerol kinase
tr|C2GBY5 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   Diacylglycerol kinase
tr|C2K6Q8 Staphylococcus aureus subsp. aureus MN8 TrEMBL   Diacylglycerol kinase
tr|C5PZM8 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Diacylglycerol kinase
tr|C5QJS2 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Diacylglycerol kinase
tr|Q2FGF4 Staphylococcus aureus (strain USA300) TrEMBL   Diacylglycerol kinase
tr|Q2FY03 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Diacylglycerol kinase, putative
tr|Q5HFJ1 Staphylococcus aureus (strain COL) TrEMBL   Diacylglycerol kinase
tr|Q6G8Z8 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative diacylglycerol kinase
tr|Q6GGD1 Staphylococcus aureus (strain MRSA252) TrEMBL   Putative diacylglycerol kinase
tr|Q7A0S4 Staphylococcus aureus (strain MW2) TrEMBL   MW1521 protein
tr|Q7A5C8 Staphylococcus aureus (strain N315) TrEMBL   SA1398 protein
tr|Q99TS7 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Similar to diacylglycerol kinase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|93062.19.peg.1576 CBS domain protein, lmo1865 homolog
9 fig|93062.19.peg.1578 DNA recombination and repair protein RecO
13 fig|93062.19.peg.1579 GTP-binding protein Era
11 fig|93062.19.peg.1580 Cytidine deaminase (EC 3.5.4.5)
28 fig|93062.19.peg.1582 Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly
15 fig|93062.19.peg.1583 PhoH-like protein, PhoL


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search