The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.1580: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Cytidine deaminase (EC 3.5.4.5)
Translate Function Assignments



Context on contig NC_002951 from base 1651649 to 1661957 (10309 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1575 1652467 1651649 819 -           ATP/GTP-binding protein, SA1392 homolog locus|SACOL1620, protein_id|YP_186460.1, gi|57651956, geneID|3238295
1576 1653017 1652478 540 - 10 5     CBS domain protein, lmo1865 homolog locus|SACOL1621, protein_id|YP_186461.1, gi|57651957, geneID|3238296
1577 1653436 1654827 1392 + 418     1: 9   Glycyl-tRNA synthetase (EC 6.1.1.14) gene_name|glyS, locus|SACOL1622, protein_id|YP_186462.1, gi|57651958, geneID|3238297
1578 1655723 1654977 747 - 149 8 2: 15 2   DNA recombination and repair protein RecO locus|SACOL1623, protein_id|YP_186463.1, gi|57651959, geneID|3238298
1579 1656650 1655751 900 - 27 11 6: 8 10 14 4 2 13   GTP-binding protein Era gene_name|era, locus|SACOL1624, protein_id|YP_186464.1, gi|57651960, geneID|3238299
1580 1657055 1656651 405 - 0   3: 7 5 12   Cytidine deaminase (EC 3.5.4.5) gene_name|cdd, locus|SACOL1625, protein_id|YP_186465.1, gi|57651961, geneID|3238300
1581 1657410 1657066 345 - 10 8 1: 11   Undecaprenol kinase (EC 2.7.1.66) gene_name|dgkA, locus|SACOL1626, protein_id|YP_186466.1, gi|57651962, geneID|3238273
1582 1657880 1657413 468 - 2 14 1: 1   Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly locus|SACOL1627, protein_id|YP_186467.1, gi|57651963, geneID|3238274
1583 1658828 1657881 948 - 0 10 3: 3 1 16   PhoH-like protein, PhoL locus|SACOL1628, protein_id|YP_186468.1, gi|57651964, geneID|3238275
1584 1659830 1659132 699 - 303         Uncharacterized membrane anchored protein YqfB locus|SACOL1629, protein_id|YP_186469.1, gi|57651965, geneID|3238276
1585 1660836 1659847 990 - 16         YqfA family protein, associated with cytidine deaminase locus|SACOL1630, protein_id|YP_186470.1, gi|57651966, geneID|3238277
1586 1661561 1660854 708 - 17         Putative membrane-bound ClpP-class protease associated with aq_911 locus|SACOL1631, protein_id|YP_186471.1, gi|57651967, geneID|3238278
1587 1661957 1661781 177 - 219     2: 17 6   SSU ribosomal protein S21p gene_name|rpsU, locus|SACOL1632, protein_id|YP_186472.1, gi|57651968, geneID|3238013

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Murein_hydrolase_regulation_and_cell_death VeronikaV Cytidine deaminase (EC 3.5.4.5)
pyrimidine_conversions RossO Cytidine deaminase (EC 3.5.4.5)
Drug_transformation_PanGenomes_IT Cytidine deaminase (EC 3.5.4.5)


  Protein Sequence

>fig|93062.19.peg.1580 Cytidine deaminase (EC 3.5.4.5)
MSYQPHYFQEVRKAQQESYSPYSQFKVGAYLKTKDGRTFYGTNVENASYPLSICAERASL
VSAISQGYRPGDFESITVTVDADKPSSPCGACRQVLKELCDDDMPVYMTNHKGDMVMMTV
AELLPFGFSGKDLE

MD5 = 1c80251453d68978f5e14362ee8eabe7


  DNA Sequence

>fig|93062.19.peg.1580 Cytidine deaminase (EC 3.5.4.5)
atgagttatcaacctcattattttcaagaagttagaaaagcacaacaagaatcatattcg
ccatacagtcaatttaaagtaggggcttatttaaaaacgaaagacggtagaactttttat
ggtaccaatgtagaaaatgcttcttatccattatcgatatgtgctgaacgagctagtttg
gtatcggcaatttctcaaggatacagaccaggtgattttgaatcaataactgtaaccgta
gatgcagataaaccgtcatcaccttgtggtgcatgtcgtcaagttttgaaggaattatgt
gatgatgatatgcctgtgtatatgacaaatcataaaggagatatggttatgatgacagtc
gcagagttactaccatttggattttcaggaaaggatttagaataa


  DNA with Flanking Sequence

>fig|93062.19.peg.1580 Cytidine deaminase (EC 3.5.4.5)
cttttgaacgagaattaggatttttagcattacatggatttttgcatctattaggttatg
atcatatgactgaagcggatgaaaaggaaatgtttggtcgacaagatacaatattaaacg
catatggattaacacgagactaattatgaaaaggtttaaatatgcacttgatgggctgaa
aatcttaattcaaaaagactataaatttcttttacatgtgtttgcaatgattgttgctat
tgtctttggtctcgtactaaatattaatcggattgagtggatatttatactcattgctat
tgcattagttctcactgttgaagctttaaacactgctattgaatatgttgtcgatttagt
gaccgttgaatatcatgatttagctaaatacgctaaagatattgcggcttttagtgtact
tatagtttcaatattagcatttattataggtttaatagtatttttaccacattttatagc
gttattttagggaggcatatatgagttatcaacctcattattttcaagaagttagaaaag
cacaacaagaatcatattcgccatacagtcaatttaaagtaggggcttatttaaaaacga
aagacggtagaactttttatggtaccaatgtagaaaatgcttcttatccattatcgatat
gtgctgaacgagctagtttggtatcggcaatttctcaaggatacagaccaggtgattttg
aatcaataactgtaaccgtagatgcagataaaccgtcatcaccttgtggtgcatgtcgtc
aagttttgaaggaattatgtgatgatgatatgcctgtgtatatgacaaatcataaaggag
atatggttatgatgacagtcgcagagttactaccatttggattttcaggaaaggatttag
aataaatgacagaacataaatcaggatttgtttcaattataggtagaccaaatgtaggaa
agtcaacatttgttaatagagtgatcggccataaaatagcaatcatgtccgataaagctc
aaacaactagaaataaaattcaaggtgttatgacaagagatgacgcgcaaattatattca
ttgatacgccaggtattcataaacctaaacacaaattaggtgactatatgatgaaagtcg
ctaaaaatacattatctgagatagatgcaatcatgtttatggttaatgccaatgaggaaa
ttggacgaggcgatgaatatattatagaaatgttgaaaaatgttaagacaccagtatttt
tagtattaaataaaatagatttagtgcatccagatgaattaatgccaaagattgaagaat
atcaaagttatatggactttacagagattgtacctatttcagcattagaagggctaaatg
tcgatcattttattgatgttttaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004126       F:cytidine deaminase activity
GO:0008270       F:zinc ion binding
GO:0046087       P:cytidine metabolic process
cmr|NT01SA1528 Staphylococcus aureus N315     cytidine deaminase
cmr|NT02SA1553 Staphylococcus aureus Mu50     cytidine deaminase
cmr|NT03SA1652 Staphylococcus aureus MW2     cytidine deaminase
cmr|NT05SA1487 Staphylococcus aureus NCTC 8325     cytidine deaminase
cmr|NT09SA1493 Staphylococcus aureus subsp. aureus MSSA476     cytidine deaminase
cmr|SACOL1625 Staphylococcus aureus subsp. aureus COL     cytidine deaminase
cmr|SAUSA300_1528 Staphylococcus aureus subsp. aureus USA300-FPR3757     cytidine deaminase
dbj|BAB42660.1 Staphylococcus aureus subsp. aureus N315     cytidine deaminase
dbj|BAB57730.1 Staphylococcus aureus subsp. aureus Mu50     cytidine deaminase
dbj|BAB95385.1 Staphylococcus aureus subsp. aureus MW2     cytidine deaminase
dbj|BAF67743.1 Staphylococcus aureus subsp. aureus str. Newman     cytidine deaminase, homotetrameric
dbj|BAF78438.1 Staphylococcus aureus subsp. aureus Mu3     cytidine deaminase
emb|CAG43307.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   cytidine deaminase
fig|158878.1.peg.1568 Staphylococcus aureus subsp. aureus Mu50 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|158878.14.peg.1614 Staphylococcus aureus subsp. aureus Mu50 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|158879.1.peg.1443 Staphylococcus aureus subsp. aureus N315 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|158879.11.peg.1503 Staphylococcus aureus subsp. aureus N315 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|196620.1.peg.1520 Staphylococcus aureus subsp. aureus MW2 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|196620.5.peg.1586 Staphylococcus aureus subsp. aureus MW2 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|282459.1.peg.1491 Staphylococcus aureus subsp. aureus MSSA476 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|282459.5.peg.1566 Staphylococcus aureus subsp. aureus MSSA476 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|359786.13.peg.1717 Staphylococcus aureus subsp. aureus JH9 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|359786.3.peg.289 Staphylococcus aureus subsp. aureus JH9 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|359787.11.peg.1694 Staphylococcus aureus subsp. aureus JH1 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|359787.3.peg.1457 Staphylococcus aureus subsp. aureus JH1 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|367830.3.peg.145 Staphylococcus aureus subsp. aureus USA300 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|418127.4.peg.1446 Staphylococcus aureus subsp. aureus Mu3 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|418127.6.peg.1592 Staphylococcus aureus subsp. aureus Mu3 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|426430.6.peg.1428 Staphylococcus aureus subsp. aureus str. Newman FIG   Cytidine deaminase (EC 3.5.4.5)
fig|426430.8.peg.1599 Staphylococcus aureus subsp. aureus str. Newman FIG   Cytidine deaminase (EC 3.5.4.5)
fig|450394.6.peg.823 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|451515.3.peg.1669 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|451516.9.peg.1659 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|452948.4.peg.209 Staphylococcus aureus 930918-3 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|455227.3.peg.1156 Staphylococcus aureus D30 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|505321.3.peg.1558 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Cytidine deaminase (EC 3.5.4.5)
fig|546342.3.peg.859 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|546343.3.peg.16 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|548474.3.peg.742 Staphylococcus aureus subsp. aureus TCH130 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|548475.3.peg.557 Staphylococcus aureus subsp. aureus TCH70 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|553565.3.peg.266 Staphylococcus aureus A5937 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|553567.3.peg.93 Staphylococcus aureus A5948 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|553568.3.peg.1044 Staphylococcus aureus A6224 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|553571.3.peg.1849 Staphylococcus aureus A6300 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|553573.3.peg.1398 Staphylococcus aureus A8115 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|553574.3.peg.412 Staphylococcus aureus A8117 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|553577.3.peg.1797 Staphylococcus aureus A8796 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|553580.3.peg.1829 Staphylococcus aureus A8819 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|553581.3.peg.1436 Staphylococcus aureus A9299 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|553588.3.peg.463 Staphylococcus aureus A9719 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|553590.4.peg.656 Staphylococcus aureus A9754 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|553592.3.peg.1367 Staphylococcus aureus A9763 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|553594.3.peg.193 Staphylococcus aureus A9765 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|553596.3.peg.499 Staphylococcus aureus A9781 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|553601.3.peg.1700 Staphylococcus aureus A10102 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|585891.3.peg.1611 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Cytidine deaminase (EC 3.5.4.5)
fig|644279.4.peg.1719 Staphylococcus aureus subsp. aureus 132 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|680649.3.peg.1159 Staphylococcus aureus subsp. aureus MR1 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|681288.4.peg.1558 Staphylococcus aureus subsp. aureus ED98 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|703339.3.peg.1553 Staphylococcus aureus 04-02981 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|762962.3.peg.418 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|93061.3.peg.1617 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|93061.5.peg.1519 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Cytidine deaminase (EC 3.5.4.5)
fig|93062.4.peg.1326 Staphylococcus aureus subsp. aureus COL FIG   Cytidine deaminase (EC 3.5.4.5)
gb|AAW38241.1 Staphylococcus aureus subsp. aureus COL     cytidine deaminase
gb|ABD21163.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     cytidine deaminase
gb|ABD30745.1 Staphylococcus aureus subsp. aureus NCTC 8325     cytidine deaminase
gb|ABQ49419.1 Staphylococcus aureus subsp. aureus JH9     cytidine deaminase
gb|ABR52508.1 Staphylococcus aureus subsp. aureus JH1     cytidine deaminase
gb|ABX29576.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     cytidine deaminase
gb|EES54669.1 Staphylococcus aureus subsp. aureus TCH70     cytidine deaminase
gb|EES92739.1 Staphylococcus aureus subsp. aureus USA300_TCH959     cytidine deaminase
gb|EES97451.1 Staphylococcus aureus subsp. aureus TCH130     cytidine deaminase
gb|EEV25956.1 Staphylococcus aureus A9781     cytidine deaminase
gb|EEV64670.1 Staphylococcus aureus A9763     cytidine deaminase
gb|EEV68245.1 Staphylococcus aureus A9719     cytidine deaminase
gb|EEV72593.1 Staphylococcus aureus A9299     cytidine deaminase
gb|EEV74955.1 Staphylococcus aureus A8115     cytidine deaminase
gb|EEV77337.1 Staphylococcus aureus A6300     cytidine deaminase
gb|EEV80894.1 Staphylococcus aureus A6224     cytidine deaminase
gb|EEV84560.1 Staphylococcus aureus A5948     cytidine deaminase
gb|EEV87025.1 Staphylococcus aureus A5937     cytidine deaminase
gb|EEW45885.1 Staphylococcus aureus 930918-3     cytidine deaminase
gb|EEW47376.1 Staphylococcus aureus D30     cytidine deaminase
gi|13701366 Staphylococcus aureus subsp. aureus N315 NCBI   cytidine deaminase
gi|14247339 Staphylococcus aureus subsp. aureus Mu50 NCBI   cytidine deaminase
gi|147741121 Staphylococcus aureus subsp. aureus JH9 NCBI   cytidine deaminase
gi|148268052 Staphylococcus aureus subsp. aureus JH9 NCBI   cytidine deaminase
gi|149946572 Staphylococcus aureus subsp. aureus JH1 NCBI   cytidine deaminase
gi|150374483 Staphylococcus aureus subsp. aureus str. Newman NCBI   cytidine deaminase, homotetrameric
gi|150394120 Staphylococcus aureus subsp. aureus JH1 NCBI   cytidine deaminase
gi|151221683 Staphylococcus aureus subsp. aureus str. Newman NCBI   cytidine deaminase
gi|156722021 Staphylococcus aureus subsp. aureus Mu3 NCBI   cytidine deaminase
gi|156979886 Staphylococcus aureus subsp. aureus Mu3 NCBI   cytidine deaminase
gi|15924558 Staphylococcus aureus subsp. aureus Mu50 NCBI   cytidine deaminase
gi|15927148 Staphylococcus aureus subsp. aureus N315 NCBI   cytidine deaminase
gi|160368605 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   cytidine deaminase
gi|161509796 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   cytidine deaminase
gi|21204689 Staphylococcus aureus subsp. aureus MW2 NCBI   cytidine deaminase
gi|21283249 Staphylococcus aureus subsp. aureus MW2 NCBI   cytidine deaminase
gi|221137874 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   cytidine deaminase
gi|221140012 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   cytidine deaminase
gi|251802012 Staphylococcus aureus subsp. aureus TCH70 NCBI   cytidine deaminase
gi|251814564 Staphylococcus aureus subsp. aureus TCH70 NCBI   cytidine deaminase
gi|253316043 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   cytidine deaminase
gi|253724010 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   cytidine deaminase
gi|253728722 Staphylococcus aureus subsp. aureus TCH130 NCBI   cytidine deaminase
gi|253732221 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   cytidine deaminase
gi|253733182 Staphylococcus aureus subsp. aureus TCH130 NCBI   cytidine deaminase
gi|255006354 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   cytidine deaminase
gi|257787616 Staphylococcus aureus A9781 NCBI   cytidine deaminase
gi|257793644 Staphylococcus aureus A9781 NCBI   cytidine deaminase
gi|257840206 Staphylococcus aureus A9763 NCBI   cytidine deaminase
gi|257843851 Staphylococcus aureus A9719 NCBI   cytidine deaminase
gi|257848605 Staphylococcus aureus A9299 NCBI   cytidine deaminase
gi|257851012 Staphylococcus aureus A8115 NCBI   cytidine deaminase
gi|257854388 Staphylococcus aureus A6300 NCBI   cytidine deaminase
gi|257858005 Staphylococcus aureus A6224 NCBI   cytidine deaminase
gi|257861761 Staphylococcus aureus A5948 NCBI   cytidine deaminase
gi|257864275 Staphylococcus aureus A5937 NCBI   cytidine deaminase
gi|258411056 Staphylococcus aureus A9763 NCBI   cytidine deaminase
gi|258420140 Staphylococcus aureus A9719 NCBI   cytidine deaminase
gi|258437400 Staphylococcus aureus A9299 NCBI   cytidine deaminase
gi|258443606 Staphylococcus aureus A8115 NCBI   cytidine deaminase
gi|258446813 Staphylococcus aureus A6300 NCBI   cytidine deaminase
gi|258448727 Staphylococcus aureus A6224 NCBI   cytidine deaminase
gi|258450603 Staphylococcus aureus A5948 NCBI   cytidine deaminase
gi|258453544 Staphylococcus aureus A5937 NCBI   cytidine deaminase
gi|259160865 Staphylococcus aureus 930918-3 NCBI   cytidine deaminase
gi|259162811 Staphylococcus aureus D30 NCBI   cytidine deaminase
gi|49244846 Staphylococcus aureus subsp. aureus MSSA476 NCBI   cytidine deaminase
gi|49486403 Staphylococcus aureus subsp. aureus MSSA476 NCBI   cytidine deaminase
gi|57286147 Staphylococcus aureus subsp. aureus COL NCBI   cytidine deaminase
gi|57651961 Staphylococcus aureus subsp. aureus COL NCBI   cytidine deaminase
gi|87126649 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   cytidine deaminase
gi|87160675 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   cytidine deaminase
gi|87202935 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   cytidine deaminase
gi|88195377 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   cytidine deaminase
img|637093063 Staphylococcus aureus aureus N315 IMG   cytidine deaminase
img|637100077 Staphylococcus aureus aureus Mu50 IMG   cytidine deaminase
img|637152365 Staphylococcus aureus aureus COL IMG   cytidine deaminase( EC:3.5.4.5 )
img|637157728 Staphylococcus aureus aureus MSSA476 IMG   cytidine deaminase( EC:3.5.4.5 )
img|637299284 Staphylococcus aureus aureus MW2 IMG   cytidine deaminase
img|637888178 Staphylococcus aureus aureus USA300 IMG   cytidine deaminase( EC:3.5.4.5 )
img|637894275 Staphylococcus aureus aureus NCTC 8325 IMG   cytidine deaminase( EC:3.5.4.5 )
img|639107766 Staphylococcus aureus aureus JH1 IMG   Cytidine deaminase, homotetrameric
img|640565972 Staphylococcus aureus aureus JH9 IMG   cytidine deaminase
img|640779742 Staphylococcus aureus aureus JH1 IMG   cytidine deaminase
img|640795852 Staphylococcus aureus aureus Newman IMG   cytidine deaminase, homotetrameric
img|640904299 Staphylococcus aureus aureus Mu3 IMG   cytidine deaminase
img|641309528 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   cytidine deaminase( EC:3.5.4.5 )
img|641772479 Staphylococcus aureus aureus USA300_TCH959 IMG   cytidine deaminase
kegg|saa:SAUSA300_1528 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   cytidine deaminase (EC:3.5.4.5)
kegg|sac:SACOL1625 Staphylococcus aureus subsp. aureus COL KEGG   cytidine deaminase (EC:3.5.4.5)
kegg|sae:NWMN_1471 Staphylococcus aureus subsp. aureus Newman KEGG   cytidine deaminase
kegg|sah:SaurJH1_1660 Staphylococcus aureus subsp. aureus JH1 KEGG   cytidine deaminase
kegg|saj:SaurJH9_1626 Staphylococcus aureus subsp. aureus JH9 KEGG   cytidine deaminase
kegg|sam:MW1520 Staphylococcus aureus subsp. aureus MW2 KEGG   cytidine deaminase
kegg|sao:SAOUHSC_01670 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   cytidine deaminase (EC:3.5.4.5)
kegg|sas:SAS1506   KEGG   cytidine deaminase (EC:3.5.4.5)
kegg|sau:SA1397   KEGG   cytidine deaminase
kegg|sav:SAV1568   KEGG   cytidine deaminase
kegg|saw:SAHV_1555 Staphylococcus aureus subsp. aureus Mu3 KEGG   cytidine deaminase
kegg|sax:USA300HOU_1569 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   cytidine deaminase (EC:3.5.4.5)
ref|NP_372092.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   cytidine deaminase
ref|NP_374681.1 Staphylococcus aureus subsp. aureus N315 RefSeq   cytidine deaminase
ref|NP_646337.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   cytidine deaminase
ref|YP_001246995.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   cytidine deaminase
ref|YP_001316795.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   cytidine deaminase
ref|YP_001332505.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   cytidine deaminase
ref|YP_001442145.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   cytidine deaminase
ref|YP_001575455.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   cytidine deaminase
ref|YP_043624.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   cytidine deaminase
ref|YP_186465.1 Staphylococcus aureus subsp. aureus COL RefSeq   cytidine deaminase
ref|YP_494223.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   cytidine deaminase
ref|YP_500181.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   cytidine deaminase
ref|ZP_03562676.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   cytidine deaminase
ref|ZP_03564505.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   cytidine deaminase
ref|ZP_04829037.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   cytidine deaminase
ref|ZP_04839256.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   cytidine deaminase
ref|ZP_04866386.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   cytidine deaminase
ref|ZP_04867347.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   cytidine deaminase
ref|ZP_05144955.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   cytidine deaminase
ref|ZP_05642623.1 Staphylococcus aureus A9781 RefSeq   cytidine deaminase
ref|ZP_05681336.1 Staphylococcus aureus A9763 RefSeq   cytidine deaminase
ref|ZP_05683095.1 Staphylococcus aureus A9719 RefSeq   cytidine deaminase
ref|ZP_05689384.1 Staphylococcus aureus A9299 RefSeq   cytidine deaminase
ref|ZP_05691945.1 Staphylococcus aureus A8115 RefSeq   cytidine deaminase
ref|ZP_05694967.1 Staphylococcus aureus A6300 RefSeq   cytidine deaminase
ref|ZP_05696839.1 Staphylococcus aureus A6224 RefSeq   cytidine deaminase
ref|ZP_05698665.1 Staphylococcus aureus A5948 RefSeq   cytidine deaminase
ref|ZP_05701522.1 Staphylococcus aureus A5937 RefSeq   cytidine deaminase
tr|A5IT96 Staphylococcus aureus (strain JH9) TrEMBL   Cytidine deaminase
tr|A6QHB1 Staphylococcus aureus (strain Newman) TrEMBL   Cytidine deaminase, homotetrameric
tr|A6U240 Staphylococcus aureus (strain JH1) TrEMBL   Cytidine deaminase
tr|A7X2W6 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Cytidine deaminase
tr|A8Z4A7 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Cytidine deaminase
tr|C5N5Z4 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Cytidine deaminase
tr|C5PZM9 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Cytidine deaminase
tr|C5QJS1 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Cytidine deaminase
tr|Q2FGF5 Staphylococcus aureus (strain USA300) TrEMBL   Cytidine deaminase
tr|Q2FY04 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Cytidine deaminase
tr|Q5HFJ2 Staphylococcus aureus (strain COL) TrEMBL   Cytidine deaminase
tr|Q6G8Z9 Staphylococcus aureus (strain MSSA476) TrEMBL   Cytidine deaminase
tr|Q7A0S5 Staphylococcus aureus (strain MW2) TrEMBL   Cytidine deaminase
tr|Q7A5C9 Staphylococcus aureus (strain N315) TrEMBL   Cytidine deaminase
tr|Q99TS8 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Cytidine deaminase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|93062.19.peg.1576 CBS domain protein, lmo1865 homolog
8 fig|93062.19.peg.1578 DNA recombination and repair protein RecO
11 fig|93062.19.peg.1579 GTP-binding protein Era
8 fig|93062.19.peg.1581 Undecaprenol kinase (EC 2.7.1.66)
14 fig|93062.19.peg.1582 Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly
10 fig|93062.19.peg.1583 PhoH-like protein, PhoL


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search