The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.1555: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Late competence protein ComGB, access of DNA to ComEA
Translate Function Assignments



Context on contig NC_002951 from base 1625947 to 1638487 (12541 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1547 1627419 1625947 1473 -       5: 12 6 2 3 7   Glycine dehydrogenase [decarboxylating] (glycine cleavage system P2 protein) (EC 1.4.4.2) locus|SACOL1593, protein_id|YP_186433.1, gi|57651929, geneID|3238025
1548 1628758 1627412 1347 - -8     2: 2 3   Glycine dehydrogenase [decarboxylating] (glycine cleavage system P1 protein) (EC 1.4.4.2) locus|SACOL1594, protein_id|YP_186434.1, gi|57651930, geneID|3238026
1549 1629869 1628778 1092 - 19     3: 2 3 14   Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10) gene_name|gcvT, locus|SACOL1595, protein_id|YP_186435.1, gi|57651931, geneID|3238027
1550 1630552 1630028 525 - 158     4: 19 17 9 21   Shikimate kinase I (EC 2.7.1.71) gene_name|aroK, locus|SACOL1596, protein_id|YP_186436.1, gi|57651932, geneID|3238028
1551 1631282 1630785 498 - 232     1: 1   Late competence protein ComGF, access of DNA to ComEA, FIG017774 locus|SACOL1597, protein_id|YP_186437.1, gi|57651933, geneID|3236386
1552 1631520 1631200 321 - -83     1: 1   Late competence protein ComGE, FIG018915  
1553 1631890 1631486 405 - -35     1: 1   Late competence protein ComGD, access of DNA to ComEA, FIG012777 locus|SACOL1598, protein_id|YP_186438.1, gi|57651934, geneID|3236387
1554 1632221 1631910 312 - 19     1: 1   Late competence protein ComGC, access of DNA to ComEA, FIG007487 gene_name|comGC, locus|SACOL1599, protein_id|YP_186439.1, gi|57651935, geneID|3236388
1555 1633305 1632235 1071 - 13     2: 1 4   Late competence protein ComGB, access of DNA to ComEA locus|SACOL1600, protein_id|YP_186440.1, gi|57651936, geneID|3236389
1556 1634251 1633277 975 - -29     2: 1 4   Late competence protein ComGA, access of DNA to ComEA locus|SACOL1601, protein_id|YP_186441.1, gi|57651937, geneID|3236390
1557 1634926 1634303 624 - 51     4: 16 8 10 18   MBL-fold metallo-hydrolase superfamily locus|SACOL1602, protein_id|YP_186442.1, gi|57651938, geneID|3236391
1558 1635252 1634923 330 - -4         DUF77 protein YqgV locus|SACOL1603, protein_id|YP_186443.1, gi|57651939, geneID|3236609
1559 1636238 1635252 987 - -1     1: 5   Glucokinase (EC 2.7.1.2) gene_name|glk, locus|SACOL1604, protein_id|YP_186444.1, gi|57651940, geneID|3236610
1560 1636438 1636235 204 - -4         Uncharacterized protein YqgQ locus|SACOL1605, protein_id|YP_186445.1, gi|57651941, geneID|3236611
1561 1637882 1636419 1464 - -20         Rhomboid family serine protease Mvan_5753 locus|SACOL1606, protein_id|YP_186446.1, gi|57651942, geneID|3236612
1562 1638487 1637894 594 - 11     4: 20 11 13 15   5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) locus|SACOL1607, protein_id|YP_186447.1, gi|57651943, geneID|3236613

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Gram_Positive_Competence RamyA Late competence protein ComGB, access of DNA to ComEA
Late_competence VeronikaV Late competence protein ComGB, access of DNA to ComEA


  Protein Sequence

>fig|93062.19.peg.1555 Late competence protein ComGB, access of DNA to ComEA
MKLQCINTFKLHSKKRQLSKAQQIDLLSNLCNLLKYGFTLYQSFQFLNLQMTYKNKQLGT
TILSEISNGAPCNQILSLIGYSDTIVMQVYLAERFGNIIDVLEETVNYMKVNRKSEQRLL
KTLQYPLILVSIFIAMIIILNLTVIPQFQQLYTSMNIQLSSFQKTLSFFITSLPTIIVVM
LIIVSMLAIIMKLIYNNLNMLNKINFVMKLPLISGYFQLFKTYFVTNELVLFYKNGITLQ
SIVDVYINHSSDPFRQFLGKYLLTYSEMGYGLPQILEKLKCFKPQLIKFVLQGEKRGKLE
VELKLYSQILVKQIEDKAIKQTQFLQPILFLILGLFIVAIYLVIMLPMFQMMQSIK

MD5 = e07f2768ca3dde00607790237ca8e444


  DNA Sequence

>fig|93062.19.peg.1555 Late competence protein ComGB, access of DNA to ComEA
gtgaaactacaatgcataaatacatttaaactacattctaagaagcgacaattaagtaag
gcccaacaaatcgacttactttcaaatttatgtaatttgttgaaatatggtttcactctg
tatcaaagttttcaatttttaaatcttcaaatgacatataaaaataagcaattaggtacc
accattctaagtgaaatttcaaatggtgcaccatgcaatcaaatattatcactgataggt
tatagcgatactatcgtcatgcaagtatatttggcagaaagatttggcaatattatagac
gttctagaagaaaccgtaaattatatgaaagtgaatagaaagtcagaacaacgattgtta
aagacactgcaataccccttaatactagtttctatctttattgctatgattattatatta
aacctcacagtaattccacagtttcaacaattatatacttctatgaatattcaactatct
tcttttcaaaaaacattgtcttttttcattaccagcttacctactataattgtagtaatg
ctcataatagtatctatgttggctattattatgaaattaatttataacaatttaaatatg
ctcaataagataaactttgtgatgaaactaccgctaatatcaggctatttccaattattt
aaaacttattttgtaactaatgaattagtgttgttttataaaaatggtattacacttcaa
tcaatagtagacgtttatattaaccatagtagtgatccatttagacagtttctaggtaaa
tacttattaacttattcagaaatgggatatggtttgcctcaaattttagaaaaactaaaa
tgctttaagcctcaattaattaagtttgtgctacaaggtgaaaagagagggaagctagaa
gtagaactaaagttatattcgcaaatattagtaaaacaaatagaagataaagcgataaaa
cagactcagtttttacagcctattttatttttgattttaggtttatttattgtcgcaatt
tatttagtaattatgttaccaatgtttcaaatgatgcaaagtataaaataa


  DNA with Flanking Sequence

>fig|93062.19.peg.1555 Late competence protein ComGB, access of DNA to ComEA
ggtctcatacgcgaataaagccttgaatttaaatgtaatttctatagaggatcctgtaga
gatgcaaattcctggtatcgtccaaattaatgtgaatgataaagctggcataaactatgt
aaattcgtttaaagctattttaagatgtgatcctgatgttattttaataggtgaaatcag
agataaagatgttgccaagtgtgttatacaggctagtttaagtggtcaccttgttctgac
tacattgcatgcaactgattgtaaaggtgctattttaaggctattagaaatgggcatttc
tgtacaagaattgatacaggcaactaacttaattataaaccaacgacttgtaactactat
taagcaacagcgacaattagtatgtgaaattctatctcagcaacaactccgatatttctt
ttcccataatcattcattaccatcatcatttaagaacttagaagataaacttgatgatat
gacaaaagcaggtgtcatttgtgaaactacaatgcataaatacatttaaactacattcta
agaagcgacaattaagtaaggcccaacaaatcgacttactttcaaatttatgtaatttgt
tgaaatatggtttcactctgtatcaaagttttcaatttttaaatcttcaaatgacatata
aaaataagcaattaggtaccaccattctaagtgaaatttcaaatggtgcaccatgcaatc
aaatattatcactgataggttatagcgatactatcgtcatgcaagtatatttggcagaaa
gatttggcaatattatagacgttctagaagaaaccgtaaattatatgaaagtgaatagaa
agtcagaacaacgattgttaaagacactgcaataccccttaatactagtttctatcttta
ttgctatgattattatattaaacctcacagtaattccacagtttcaacaattatatactt
ctatgaatattcaactatcttcttttcaaaaaacattgtcttttttcattaccagcttac
ctactataattgtagtaatgctcataatagtatctatgttggctattattatgaaattaa
tttataacaatttaaatatgctcaataagataaactttgtgatgaaactaccgctaatat
caggctatttccaattatttaaaacttattttgtaactaatgaattagtgttgttttata
aaaatggtattacacttcaatcaatagtagacgtttatattaaccatagtagtgatccat
ttagacagtttctaggtaaatacttattaacttattcagaaatgggatatggtttgcctc
aaattttagaaaaactaaaatgctttaagcctcaattaattaagtttgtgctacaaggtg
aaaagagagggaagctagaagtagaactaaagttatattcgcaaatattagtaaaacaaa
tagaagataaagcgataaaacagactcagtttttacagcctattttatttttgattttag
gtttatttattgtcgcaatttatttagtaattatgttaccaatgtttcaaatgatgcaaa
gtataaaataatggaggttaatatatgtttaaatttcttaagaaaactcaagcgtttaca
ttgatagagatgctattagtgttattaatcatcagtttattattaattttaatcattcca
aatattgctaaacaaactgctcacatacaatcaacaggttgtaatgcacaggtaaaaatg
gttaatagtcaaattgaagcgtatgcattgaaacataatagaaatccatcgtctattgaa
gacttaattgcagatggttttataaaagaagcacaaaagacatgtaaatcaggagagaca
atcacaattagtaatggagaagcagttgcaaattagaaagcagtcagcatttactatgat
tgagatgcttgtggtaatgatgttaatcagtatatttctacttttgacaatgacatctaa
aggattaagcaatcttagagtaatagatgatgaggcaaatatcatttcttttattactga
attgaattatattaagtcgcaagctatagca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|SACOL1600 Staphylococcus aureus subsp. aureus COL     competence protein ComGB, putative
cmr|SAUSA300_1503 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative competence protein ComGB
dbj|BAF67719.1 Staphylococcus aureus subsp. aureus str. Newman     competence protein ComGB homolog
fig|367830.3.peg.2513 Staphylococcus aureus subsp. aureus USA300 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|426430.6.peg.1404 Staphylococcus aureus subsp. aureus str. Newman FIG   Late competence protein ComGB, access of DNA to ComEA
fig|426430.8.peg.1574 Staphylococcus aureus subsp. aureus str. Newman FIG   Late competence protein ComGB, access of DNA to ComEA
fig|451515.3.peg.1644 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|451516.9.peg.1634 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|452948.4.peg.234 Staphylococcus aureus 930918-3 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|455227.3.peg.1130 Staphylococcus aureus D30 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|546342.3.peg.831 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|546343.3.peg.41 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|553567.3.peg.118 Staphylococcus aureus A5948 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|553590.4.peg.631 Staphylococcus aureus A9754 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|553594.3.peg.168 Staphylococcus aureus A9765 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|644279.4.peg.1694 Staphylococcus aureus subsp. aureus 132 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|93062.4.peg.1301 Staphylococcus aureus subsp. aureus COL FIG   Late competence protein ComGB, access of DNA to ComEA
gb|AAW38216.1 Staphylococcus aureus subsp. aureus COL     competence protein ComGB, putative
gb|ABD20482.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative competence protein ComGB
gb|ABX29552.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     competence protein ComGB
gb|EEV84585.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW45862.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1636
gi|150374459 Staphylococcus aureus subsp. aureus str. Newman NCBI   competence protein ComGB homolog
gi|151221659 Staphylococcus aureus subsp. aureus str. Newman NCBI   competence protein ComGB-like protein
gi|160368581 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   competence protein ComGB
gi|161509772 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   competence protein ComGB
gi|221137852 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   competence protein ComGB
gi|221140037 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   competence protein ComGB
gi|257861786 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258450628 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259160842 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1636
gi|57286122 Staphylococcus aureus subsp. aureus COL NCBI   competence protein ComGB, putative
gi|57651936 Staphylococcus aureus subsp. aureus COL NCBI   competence protein ComGB, putative
gi|87125968 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative competence protein ComGB
gi|87159994 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative competence protein ComGB
img|637152340 Staphylococcus aureus aureus COL IMG   competence protein ComGB, putative
img|637888153 Staphylococcus aureus aureus USA300 IMG   putative competence protein ComGB
img|640795828 Staphylococcus aureus aureus Newman IMG   competence protein ComGB homolog
img|641309504 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   competence protein ComGB
img|641771855 Staphylococcus aureus aureus USA300_TCH959 IMG   competence protein ComGB
kegg|saa:SAUSA300_1503 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   putative competence protein ComGB
kegg|sac:SACOL1600 Staphylococcus aureus subsp. aureus COL KEGG   competence protein ComGB, putative
kegg|sae:NWMN_1447 Staphylococcus aureus subsp. aureus Newman KEGG   competence protein ComGB-like protein
kegg|sax:USA300HOU_1545 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   competence protein ComGB
ref|YP_001332481.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   competence protein ComGB-like protein
ref|YP_001575431.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   competence protein ComGB
ref|YP_186440.1 Staphylococcus aureus subsp. aureus COL RefSeq   competence protein ComGB, putative
ref|YP_494198.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   putative competence protein ComGB
ref|ZP_03562654.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   competence protein ComGB
ref|ZP_03564530.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   competence protein ComGB
ref|ZP_05698690.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QH87 Staphylococcus aureus (strain Newman) TrEMBL   Competence protein ComGB homolog
tr|A8Z483 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Competence protein ComGB
tr|Q2FGI0 Staphylococcus aureus (strain USA300) TrEMBL   Putative competence protein ComGB
tr|Q5HFL7 Staphylococcus aureus (strain COL) TrEMBL   Competence protein ComGB, putative


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search