The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.1448: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: 23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
Translate Function Assignments



Context on contig NC_002951 from base 1518288 to 1530400 (12113 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1445 1521728 1518288 3441 -           FIG01108718: hypothetical protein locus|SACOL1480, protein_id|YP_186325.1, gi|57650396, geneID|3238626
1446 1522032 1523372 1341 + 303         Uncharacterized iron-regulated membrane protein; Iron-uptake factor PiuB locus|SACOL1481, protein_id|YP_186326.1, gi|57650397, geneID|3237933
1447 1523910 1523578 333 - 205         FIG01108065: hypothetical protein locus|SACOL1482, protein_id|YP_186327.1, gi|57650398, geneID|3236284
1448 1525139 1523994 1146 - 83   1: 1   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173) locus|SACOL1483, protein_id|YP_186328.1, gi|57650399, geneID|3237809
1449 1526134 1525790 345 - 650 7 1: 1   Cell division protein GpsB, coordinates the switch between cylindrical and septal cell wall synthesis by re-localization of PBP1 locus|SACOL1484, protein_id|YP_186329.1, gi|57650400, geneID|3236286
1450 1526711 1526148 564 - 13 7 1: 1   UPF0398 protein YpsA locus|SACOL1485, protein_id|YP_186330.1, gi|57650401, geneID|3237411
1451 1527105 1526704 402 - -8         FIG01108162: hypothetical protein locus|SACOL1486, protein_id|YP_186331.1, gi|57650402, geneID|3237555
1452 1527288 1527109 180 - 3         FIG01108241: hypothetical protein  
1453 1527543 1528220 678 + 254 6 1: 1   RecU Holliday junction resolvase gene_name|recU, locus|SACOL1489, protein_id|YP_186333.1, gi|57650404, geneID|3237565
1454 1528532 1530400 1869 + 311 7 2: 2 1   Multimodular transpeptidase-transglycosylase (EC 2.4.1.129) (EC 3.4.-.-) / Penicillin-binding protein 1A/1B (PBP1) gene_name|pbp2, locus|SACOL1490, protein_id|YP_186334.1, gi|57650405, geneID|3237601

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Control_of_cell_elongation_-_division_cycle_in_Bacilli SvetaG FIG001721: Predicted N6-adenine-specific DNA methylase


  Protein Sequence

>fig|93062.19.peg.1448 23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
MFQLLAVCPMGLEAVVAREIQELGYETNVENGRIFFEGDASAIVKANLWLRTADRIKIVV
GRFNATTFDELFEQTKALPWESIIDKEGNFPVQGRSVKSTLHSVPDCQAITKKAIVERLR
RAYNEKGWLNESGAKYPVEVAILKDNVLLTIDTSGSGLNRRGYRLAQGEAPIKETLAASL
IRLANWKGDTPLIDPFCGSGTIAIEACLIAQNIAPGFNREFVSEQWNIMPANIYDDYRDE
ADKMADYDKEIEVYASDIDPEMVEIAKRNAEEVGLSDIIKFSVKDVNTLTIDTEEPVALI
GNPPYGERIGDREEVEEMYRYIGKLMKQHPFLSTYILTSNKEFEYLVDRKATKRRKLFNG
YIECTYYQYWGKKTERKTIEN

MD5 = 8468f131866673309cae3552d1a0076b


  DNA Sequence

>fig|93062.19.peg.1448 23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
atgtttcaattacttgcagtttgtccgatgggattagaagctgttgttgctagggaaatt
caagaattaggctatgaaacaaatgttgaaaatggtcgtatattttttgaaggagacgca
agtgcaattgtaaaggcaaatttatggttgcgcacagcagaccgaatcaaaattgttgtt
ggacgttttaacgcaacaacgtttgacgaattattcgaacaaaccaaagcgctcccttgg
gaatctataattgataaagagggtaacttcccagttcaaggtagaagcgttaaatcaaca
ctacatagtgtgccagattgtcaggcgataactaagaaagctattgttgaacgattacgt
cgcgcatataacgaaaaaggttggttaaatgaatcaggtgccaaataccctgttgaagtt
gccattttaaaagataatgtattattgactatcgacacatcaggttctggtttgaacaga
cgtggttatagattagcacaaggtgaagcaccaattaaagaaacgttggcagcaagttta
atccgtcttgcaaactggaaaggtgatacacctttaattgatccattttgcggttcgggt
acaatagctatagaagcttgtttaattgctcaaaatatcgcacctggttttaatcgcgag
ttcgtatcagagcaatggaacatcatgccagcaaatatttatgatgattaccgtgatgaa
gcggataagatggctgattatgataaagaaatcgaagtatatgcttctgatatcgatcca
gaaatggtagagattgctaagcgtaacgctgaagaagttgggttgtctgatattattaaa
tttagtgtaaaagatgtcaatacattaacaattgatacagaagaaccggtggcgttaatt
ggaaatcctccatatggtgaacgtattggtgatcgtgaagaagttgaagaaatgtaccgt
tatattggtaaactaatgaaacaacatccatttttatctacatacattttaacaagtaat
aaagaatttgaatatttagtagatcgtaaagcaacaaagcgacgtaagttatttaatgga
tatatagaatgtacttattatcaatactggggtaaaaagacagaacgtaaaactattgaa
aactaa


  DNA with Flanking Sequence

>fig|93062.19.peg.1448 23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
aaatcaaggcattaatttgacggcaatgaaatatcctaagtctttcgatatggatagagt
aatttgaaagtgccacagtgacgtagcttttatagaaatataaaaggtggaacgcggtaa
acccctcgagtgagcaatccaaatttggtaggagcacttgtttaacggaattcaacgtat
aaacgagacacacttcgcgaaatgaagtggtgtagacagatggttatcacctgagtacca
gtgtgactagtgcacgtgatgagtacgatggaacagaacatggcttatagaaatatcact
actagtttagctctcctagatgatggagagcttttttcatgaaaagaacacttaaaatta
acgccttgtcttgatataatgacactgccttgttttaaaatagtaagcggatgcgttaat
gtatcagcgattaaatttgttggaaatgtataaaaaacacaagctaagaataaaatacct
gtataaaaggagaatcatatatgtttcaattacttgcagtttgtccgatgggattagaag
ctgttgttgctagggaaattcaagaattaggctatgaaacaaatgttgaaaatggtcgta
tattttttgaaggagacgcaagtgcaattgtaaaggcaaatttatggttgcgcacagcag
accgaatcaaaattgttgttggacgttttaacgcaacaacgtttgacgaattattcgaac
aaaccaaagcgctcccttgggaatctataattgataaagagggtaacttcccagttcaag
gtagaagcgttaaatcaacactacatagtgtgccagattgtcaggcgataactaagaaag
ctattgttgaacgattacgtcgcgcatataacgaaaaaggttggttaaatgaatcaggtg
ccaaataccctgttgaagttgccattttaaaagataatgtattattgactatcgacacat
caggttctggtttgaacagacgtggttatagattagcacaaggtgaagcaccaattaaag
aaacgttggcagcaagtttaatccgtcttgcaaactggaaaggtgatacacctttaattg
atccattttgcggttcgggtacaatagctatagaagcttgtttaattgctcaaaatatcg
cacctggttttaatcgcgagttcgtatcagagcaatggaacatcatgccagcaaatattt
atgatgattaccgtgatgaagcggataagatggctgattatgataaagaaatcgaagtat
atgcttctgatatcgatccagaaatggtagagattgctaagcgtaacgctgaagaagttg
ggttgtctgatattattaaatttagtgtaaaagatgtcaatacattaacaattgatacag
aagaaccggtggcgttaattggaaatcctccatatggtgaacgtattggtgatcgtgaag
aagttgaagaaatgtaccgttatattggtaaactaatgaaacaacatccatttttatcta
catacattttaacaagtaataaagaatttgaatatttagtagatcgtaaagcaacaaagc
gacgtaagttatttaatggatatatagaatgtacttattatcaatactggggtaaaaaga
cagaacgtaaaactattgaaaactaaagtgtttctaatgcgtgactaaaattagtaataa
ttaagttctcatgataataggtatttttgaaaaatggaggagtctataaatgggtaaaaa
aatgggtctaggtttatctattgcattggttgttattggtattgccgttgtatgtttaat
gattttttctagtcaaaaaacgacttattttggttatatgaatagtaatacaaatgcaga
aaaagttgtcagtgaaaaagatggattagtcaaacataatatcaaagtagaaccatctaa
tgatttcaagccgaaaaaaggaggctttgtaaaattagtttctaaagatgatgggaagac
attttataaacaagagattgttaaacatgatgacgtcccacacggtttaatgatgaaaat
tcacgacatgcatatgaattaataaaaaagcatctataacgtaattttgaagaagtagag
ttatcttcttatgcgttttagatgcttttttatcttcaaattcaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0008168       F:methyltransferase activity
GO:0009007       F:site-specific DNA-methyltransferase (adenin...
cmr|NT03SA1457 Staphylococcus aureus MW2     Putative RNA methylase family UPF0020 family
cmr|NT05SA1299 Staphylococcus aureus NCTC 8325     methyltransferase
cmr|NT08SA1419 Staphylococcus aureus subsp. aureus MRSA252     Putative RNA methylase family UPF0020 family, putative
cmr|NT09SA1375 Staphylococcus aureus subsp. aureus MSSA476     Putative RNA methylase family UPF0020 family, putative
cmr|SACOL1483 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_1336 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB95198.1 Staphylococcus aureus subsp. aureus MW2     conserved hypothetical protein
dbj|BAF67626.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
emb|CAG40453.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   conserved hypothetical protein
emb|CAG43163.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   conserved hypothetical protein
fig|196620.1.peg.1333 Staphylococcus aureus subsp. aureus MW2 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|196620.5.peg.1398 Staphylococcus aureus subsp. aureus MW2 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|282458.1.peg.1375 Staphylococcus aureus subsp. aureus MRSA252 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|282458.4.peg.1458 Staphylococcus aureus subsp. aureus MRSA252 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|282459.1.peg.1372 Staphylococcus aureus subsp. aureus MSSA476 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|282459.5.peg.1444 Staphylococcus aureus subsp. aureus MSSA476 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|367830.3.peg.1558 Staphylococcus aureus subsp. aureus USA300 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|426430.6.peg.1313 Staphylococcus aureus subsp. aureus str. Newman FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|426430.8.peg.1474 Staphylococcus aureus subsp. aureus str. Newman FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|451515.3.peg.1463 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|451516.9.peg.1468 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|452948.4.peg.607 Staphylococcus aureus 930918-3 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|455227.3.peg.964 Staphylococcus aureus D30 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|546342.3.peg.1310 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|546343.3.peg.1012 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|548470.3.peg.380 Staphylococcus aureus subsp. aureus MN8 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|548473.3.peg.1893 Staphylococcus aureus subsp. aureus TCH60 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|548475.3.peg.368 Staphylococcus aureus subsp. aureus TCH70 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|553567.3.peg.586 Staphylococcus aureus A5948 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|553590.4.peg.464 Staphylococcus aureus A9754 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|553594.3.peg.724 Staphylococcus aureus A9765 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|585143.3.peg.1648 Staphylococcus aureus subsp. aureus 55/2053 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|585144.3.peg.1379 Staphylococcus aureus subsp. aureus 58-424 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|585145.3.peg.1644 Staphylococcus aureus subsp. aureus 65-1322 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|585146.3.peg.1643 Staphylococcus aureus subsp. aureus 68-397 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|585147.3.peg.1050 Staphylococcus aureus subsp. aureus A017934/97 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|585148.3.peg.966 Staphylococcus aureus subsp. aureus Btn1260 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|585149.6.peg.1549 Staphylococcus aureus subsp. aureus C101 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|585150.3.peg.1701 Staphylococcus aureus subsp. aureus C160 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|585151.3.peg.1372 Staphylococcus aureus subsp. aureus C427 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|585152.3.peg.1428 Staphylococcus aureus subsp. aureus D139 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|585153.3.peg.1720 Staphylococcus aureus subsp. aureus E1410 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|585154.3.peg.1075 Staphylococcus aureus subsp. aureus EMRSA16 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|585156.3.peg.931 Staphylococcus aureus subsp. aureus M1015 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|585158.3.peg.1898 Staphylococcus aureus subsp. aureus M876 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|585159.3.peg.1504 Staphylococcus aureus subsp. aureus M899 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|585160.3.peg.925 Staphylococcus aureus subsp. aureus WBG10049 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|762962.3.peg.599 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|93061.3.peg.1371 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|93061.5.peg.1329 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
fig|93062.4.peg.1714 Staphylococcus aureus subsp. aureus COL FIG   23S rRNA (guanine(2445)-N(2))-methyltransferase (EC 2.1.1.173)
gb|AAW36679.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD21700.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD30546.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX29391.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     site-specific DNA-methyltransferase (adenine-specific)
gb|EEI95086.1 Staphylococcus aureus subsp. aureus MN8     site-specific DNA-methyltransferase (adenine-specific)
gb|EEJ61868.1 Staphylococcus aureus subsp. aureus TCH60     site-specific DNA-methyltransferase (adenine-specific)
gb|EES54762.1 Staphylococcus aureus subsp. aureus TCH70     site-specific DNA-methyltransferase
gb|EEV04105.1 Staphylococcus aureus subsp. aureus 55/2053     site-specific DNA-methyltransferase
gb|EEV06497.1 Staphylococcus aureus subsp. aureus 65-1322     site-specific DNA-methyltransferase
gb|EEV09546.1 Staphylococcus aureus subsp. aureus 68-397     site-specific DNA-methyltransferase
gb|EEV11787.1 Staphylococcus aureus subsp. aureus E1410     site-specific DNA-methyltransferase
gb|EEV14801.1 Staphylococcus aureus subsp. aureus M876     conserved hypothetical protein
gb|EEV83970.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW45483.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1895
gb|EEW47465.1 Staphylococcus aureus D30     hypothetical protein SAD30_1248
gi|150374366 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151221566 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_1354
gi|160368420 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   site-specific DNA-methyltransferase (adenine-specific)
gi|161509611 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1381
gi|21204501 Staphylococcus aureus subsp. aureus MW2 NCBI   conserved hypothetical protein
gi|21283062 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW1333
gi|221138299 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_06593
gi|221140989 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_05043
gi|227245327 Staphylococcus aureus subsp. aureus MN8 NCBI   site-specific DNA-methyltransferase (adenine-specific)
gi|227558302 Staphylococcus aureus subsp. aureus MN8 NCBI   site-specific DNA-methyltransferase (adenine-specific)
gi|227852070 Staphylococcus aureus subsp. aureus TCH60 NCBI   site-specific DNA-methyltransferase (adenine-specific)
gi|227900110 Staphylococcus aureus subsp. aureus TCH60 NCBI   site-specific DNA-methyltransferase (adenine-specific)
gi|251802105 Staphylococcus aureus subsp. aureus TCH70 NCBI   site-specific DNA-methyltransferase
gi|251814370 Staphylococcus aureus subsp. aureus TCH70 NCBI   site-specific DNA-methyltransferase
gi|257271967 Staphylococcus aureus subsp. aureus 55/2053 NCBI   site-specific DNA-methyltransferase
gi|257275010 Staphylococcus aureus subsp. aureus 65-1322 NCBI   site-specific DNA-methyltransferase
gi|257278927 Staphylococcus aureus subsp. aureus 68-397 NCBI   site-specific DNA-methyltransferase
gi|257281650 Staphylococcus aureus subsp. aureus E1410 NCBI   site-specific DNA-methyltransferase
gi|257284681 Staphylococcus aureus subsp. aureus M876 NCBI   conserved hypothetical protein
gi|257425510 Staphylococcus aureus subsp. aureus 55/2053 NCBI   site-specific DNA-methyltransferase
gi|257428169 Staphylococcus aureus subsp. aureus 65-1322 NCBI   site-specific DNA-methyltransferase
gi|257430799 Staphylococcus aureus subsp. aureus 68-397 NCBI   site-specific DNA-methyltransferase
gi|257433557 Staphylococcus aureus subsp. aureus E1410 NCBI   site-specific DNA-methyltransferase
gi|257436399 Staphylococcus aureus subsp. aureus M876 NCBI   conserved hypothetical protein
gi|257861157 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258451102 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259160459 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1895
gi|259162902 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1248
gi|49241762 Staphylococcus aureus subsp. aureus MRSA252 NCBI   conserved hypothetical protein
gi|49244727 Staphylococcus aureus subsp. aureus MSSA476 NCBI   conserved hypothetical protein
gi|49483633 Staphylococcus aureus subsp. aureus MRSA252 NCBI   hypothetical protein SAR1456
gi|49486284 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS1387
gi|57284585 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57650399 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL1483
gi|87127186 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87161212 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_1336
gi|87202736 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88195178 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01460
img|637152228 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637154882 Staphylococcus aureus aureus MRSA252 IMG   hypothetical protein
img|637157609 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637299097 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637887988 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637894073 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640795735 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641309342 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   site-specific DNA-methyltransferase (adenine-specific)( EC:2.1.1.72 )
img|641772691 Staphylococcus aureus aureus USA300_TCH959 IMG   site-specific DNA-methyltransferase (adenine-specific)
kegg|saa:SAUSA300_1336 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL1483 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_1354 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sam:MW1333 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_01460 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sar:SAR1456   KEGG   hypothetical protein
kegg|sas:SAS1387   KEGG   hypothetical protein
kegg|sax:USA300HOU_1381 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein (EC:2.1.1.72)
ref|NP_646150.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW1333
ref|YP_001332388.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_1354
ref|YP_001575270.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_1381
ref|YP_040857.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   hypothetical protein SAR1456
ref|YP_043505.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS1387
ref|YP_186328.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL1483
ref|YP_494033.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_1336
ref|YP_499979.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01460
ref|ZP_03563101.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_06593
ref|ZP_03565482.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_05043
ref|ZP_03988349.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   site-specific DNA-methyltransferase (adenine-specific)
ref|ZP_04017915.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   site-specific DNA-methyltransferase (adenine-specific)
ref|ZP_04828843.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   site-specific DNA-methyltransferase
ref|ZP_05601935.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   site-specific DNA-methyltransferase
ref|ZP_05604567.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   site-specific DNA-methyltransferase
ref|ZP_05607181.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   site-specific DNA-methyltransferase
ref|ZP_05609915.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   site-specific DNA-methyltransferase
ref|ZP_05612446.1 Staphylococcus aureus subsp. aureus M876 RefSeq   conserved hypothetical protein
ref|ZP_05699137.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QGZ4 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z423 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Site-specific DNA-methyltransferase (Adenine-specific)
tr|C2GB44 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   Site-specific DNA-methyltransferase (Adenine-specific)
tr|C2K8A9 Staphylococcus aureus subsp. aureus MN8 TrEMBL   Site-specific DNA-methyltransferase (Adenine-specific)
tr|C5QJ77 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Site-specific DNA-methyltransferase
tr|Q2FGZ5 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2FYI6 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HFX9 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6G9B8 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative uncharacterized protein
tr|Q6GGW5 Staphylococcus aureus (strain MRSA252) TrEMBL   Putative uncharacterized protein
tr|Q8NWP8 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW1333


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
7 fig|93062.19.peg.1449 Cell division protein GpsB, coordinates the switch between cylindrical and septal cell wall synthesis by re-localization of PBP1
7 fig|93062.19.peg.1450 UPF0398 protein YpsA
6 fig|93062.19.peg.1453 RecU Holliday junction resolvase
7 fig|93062.19.peg.1454 Multimodular transpeptidase-transglycosylase (EC 2.4.1.129) (EC 3.4.-.-) / Penicillin-binding protein 1A/1B (PBP1)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search