The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.1244: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: GTP-sensing transcriptional pleiotropic repressor CodY
Translate Function Assignments



Context on contig NC_002951 from base 1276590 to 1289789 (13200 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1239 1276590 1278659 2070 +   13 4: 9 5 4 7   DNA topoisomerase I (EC 5.99.1.2) gene_name|topA, locus|SACOL1267, protein_id|YP_186125.1, gi|57651819, geneID|3238359
1240 1278815 1280122 1308 + 155 11 5: 15 10 8 5 4   Methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))-methyltransferase TrmFO (EC 2.1.1.74) gene_name|gid, locus|SACOL1268, protein_id|YP_186126.1, gi|57651820, geneID|3238029
1241 1280539 1281435 897 + 416 7 1: 2   Site-specific tyrosine recombinase gene_name|xerC, locus|SACOL1269, protein_id|YP_186127.1, gi|57651821, geneID|3238030
1242 1281432 1281977 546 + -4 9 2: 6 2   ATP-dependent protease subunit HslV (EC 3.4.25.2) gene_name|hslV, locus|SACOL1270, protein_id|YP_186128.1, gi|57651822, geneID|3238031
1243 1282043 1283446 1404 + 65 12 2: 6 2   ATP-dependent hsl protease ATP-binding subunit HslU gene_name|hslU, locus|SACOL1271, protein_id|YP_186129.1, gi|57651823, geneID|3238032
1244 1283471 1284244 774 + 24   1: 4   GTP-sensing transcriptional pleiotropic repressor CodY gene_name|codY, locus|SACOL1272, protein_id|YP_186130.1, gi|57651824, geneID|3238033
1245 1284586 1285362 777 + 341     4: 19 11 3 1   SSU ribosomal protein S2p (SAe) gene_name|rpsB, locus|SACOL1274, protein_id|YP_186131.1, gi|57651825, geneID|3238505
1246 1285544 1286425 882 + 181     4: 17 18 3 1   Translation elongation factor Ts gene_name|tsf, locus|SACOL1276, protein_id|YP_186133.1, gi|57651827, geneID|3238507
1247 1286562 1287284 723 + 136 6 2: 3 1 dlit(17210578) Uridylate kinase (EC 2.7.4.22) gene_name|pyrH, locus|SACOL1277, protein_id|YP_186134.1, gi|57651828, geneID|3238508
1248 1287303 1287857 555 + 18 8 2: 13 1   Ribosome recycling factor gene_name|frr, locus|SACOL1278, protein_id|YP_186135.1, gi|57651829, geneID|3238509
1249 1288230 1289000 771 + 372 8 2: 16 12   Undecaprenyl diphosphate synthase (EC 2.5.1.31) gene_name|uppS, locus|SACOL1279, protein_id|YP_186136.1, gi|57651830, geneID|3238385
1250 1289007 1289789 783 + 6 6 2: 20 14   Phosphatidate cytidylyltransferase (EC 2.7.7.41) gene_name|cdsA, locus|SACOL1280, protein_id|YP_186137.1, gi|57651831, geneID|3238386

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Conserved_gene_cluster_associated_with_Met-tRNA_formyltransferase SvetaG GTP-sensing transcriptional pleiotropic repressor codY


  Protein Sequence

>fig|93062.19.peg.1244 GTP-sensing transcriptional pleiotropic repressor CodY
MSLLSKTRELNTLLQKHKGIAVDFKDVAQTISSVTVTNVFIVSRRGKILGSSLNELLKSQ
RIIQMLEERHIPSEYTERLMEVKQTESNIDIDNVLTVFPPENRELFIDSRTTIFPILGGG
ERLGTLVLGRVHDDFNENDLVLGEYAATVIGMEILREKHSEVEKEARDKAAITMAINSLS
YSEKEAIEHIFEELGGTEGLLIASKVADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
FIKVKKEKFLDELEKSK

MD5 = 888d690a64f391e3bb7e292cd5537ca1


  DNA Sequence

>fig|93062.19.peg.1244 GTP-sensing transcriptional pleiotropic repressor CodY
atgagcttattatctaaaacgagagagttaaacacgttacttcaaaaacacaaaggtatt
gcggttgattttaaagatgtagcacaaacgattagtagcgtaactgtaacaaatgtattt
attgtatcgcgtcgaggtaaaattttaggatcgagtctaaatgaattattaaaaagtcaa
agaattattcaaatgttggaagaaagacatattccaagtgaatatacagaacgattaatg
gaagttaaacaaacagaatcaaatattgatatcgacaatgtattaacagtattcccacct
gaaaacagagaattattcatagatagtcgtacaactatcttcccaattttaggtggaggg
gaaagattaggtacattagtacttggtcgagtacatgatgattttaatgaaaatgatttg
gtactaggtgaatatgctgctacagttattggtatggaaatcttacgtgagaagcatagt
gaagtagaaaaagaagcgcgcgataaagctgctattacaatggcaattaattcattatct
tattctgaaaaagaagcgattgaacatatctttgaagaacttggcggtacggaaggccta
ttaatcgcatcaaaagttgcagatagagttggtattactagatctgtaattgtaaatgca
ctacgtaaattagaaagtgctggtgtaattgaatcacgttctttaggaatgaaaggtact
ttcattaaagttaaaaaagaaaaattcttagatgaattagaaaaaagtaaataa


  DNA with Flanking Sequence

>fig|93062.19.peg.1244 GTP-sensing transcriptional pleiotropic repressor CodY
aaggtagcgttattcaaaccaaatatggtactgtgaatactgaacatatgctgtttatag
gtgctggagctttccatgtatctaagccgagtgacttgataccagaattgcaaggtcgtt
ttccgattagagttgaacttgatagtttatcggtagaagattttgtaagaattttgacag
aaccaaaattgtcattaattaaacaatatgaagcattgcttcaaacagaagaagttactg
taaactttaccgatgaagcaattactcgcttagctgagattgcttatcaagtaaatcaag
atacagacaacattggtgcacgtcgacttcatacaattttagaaaagatgctagaagatt
tatcattcgaagcaccaagtatgccgaatgcagttgtagatattaccccacaatatgttg
atgataaattaaaatcaatttcaacaaataaagatttaagtgcatttattctataaaaat
atacaaaaggagaaaaattcatgagcttattatctaaaacgagagagttaaacacgttac
ttcaaaaacacaaaggtattgcggttgattttaaagatgtagcacaaacgattagtagcg
taactgtaacaaatgtatttattgtatcgcgtcgaggtaaaattttaggatcgagtctaa
atgaattattaaaaagtcaaagaattattcaaatgttggaagaaagacatattccaagtg
aatatacagaacgattaatggaagttaaacaaacagaatcaaatattgatatcgacaatg
tattaacagtattcccacctgaaaacagagaattattcatagatagtcgtacaactatct
tcccaattttaggtggaggggaaagattaggtacattagtacttggtcgagtacatgatg
attttaatgaaaatgatttggtactaggtgaatatgctgctacagttattggtatggaaa
tcttacgtgagaagcatagtgaagtagaaaaagaagcgcgcgataaagctgctattacaa
tggcaattaattcattatcttattctgaaaaagaagcgattgaacatatctttgaagaac
ttggcggtacggaaggcctattaatcgcatcaaaagttgcagatagagttggtattacta
gatctgtaattgtaaatgcactacgtaaattagaaagtgctggtgtaattgaatcacgtt
ctttaggaatgaaaggtactttcattaaagttaaaaaagaaaaattcttagatgaattag
aaaaaagtaaataagtcgatgagtctgggacataattcaatgtcctagtcgtgacgatgt
tatcttggcggtagtcaatgaaatgactttgatgattatgttgaagtcatttctttattt
ttgtctaattttcaatcaaattgatatttcacattaacttgatagaattacctttaaatt
tatggaaaaatgcttgaaaaacatttgctttagacacggcattatgttatatttattttc
ggctataaagccaatacacacatatcaaacgtgattgtgtaaagggtgcaatatttatat
attgtctttacaatagtttgctatggaggtaattaaccaataggaggaatttataatggc
agtaatttcaatgaaacaattactagaagcgggtgttcacttcggtcaccaaacacgtcg
ttggaacccaaaaatgaaaaaatatatcttcactgagagaaatggtatttatatcatcga
cttacaaaaaacagtgaaaaaagtagacgaggca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
GO:0005525       F:GTP binding
GO:0005737       C:cytoplasm
GO:0006350       P:transcription
GO:0016564       F:transcription repressor activity
GO:0045892       P:negative regulation of transcription, DNA-d...
cmr|NT01SA1194 Staphylococcus aureus N315     transcriptional regulator
cmr|NT02SA1243 Staphylococcus aureus Mu50     GTP-sensing transcriptional pleiotropic repressor codY
cmr|NT03SA1239 Staphylococcus aureus MW2     dipeptide transport operon repressor
cmr|NT05SA1103 Staphylococcus aureus NCTC 8325     GTP-sensing transcriptional pleiotropic repressor CodY
cmr|NT08SA1202 Staphylococcus aureus subsp. aureus MRSA252     transcription pleiotropic repressor codY , putative
cmr|NT09SA1180 Staphylococcus aureus subsp. aureus MSSA476     transcription pleiotropic repressor codY , putative
cmr|SACOL1272 Staphylococcus aureus subsp. aureus COL     transcriptional regulator CodY
cmr|SAUSA300_1148 Staphylococcus aureus subsp. aureus USA300-FPR3757     GTP-sensing transcriptional pleiotropic repressor CodY
dbj|BAB42350.1 Staphylococcus aureus subsp. aureus N315     transcription pleiotropic repressor codY
dbj|BAB57417.1 Staphylococcus aureus subsp. aureus Mu50     transcription pleiotropic repressor
dbj|BAB95003.1 Staphylococcus aureus subsp. aureus MW2     transcription pleiotropic repressor codY
dbj|BAF67437.1 Staphylococcus aureus subsp. aureus str. Newman     GTP-sensing transcriptional pleiotropic repressor CodY
dbj|BAF78128.1 Staphylococcus aureus subsp. aureus Mu3     transcription pleiotropic repressor
emb|CAG40233.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   putative regulatory protein
emb|CAG42966.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative regulatory protein
fig|158878.1.peg.1255 Staphylococcus aureus subsp. aureus Mu50 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|158878.14.peg.1289 Staphylococcus aureus subsp. aureus Mu50 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|158879.1.peg.1133 Staphylococcus aureus subsp. aureus N315 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|158879.11.peg.1177 Staphylococcus aureus subsp. aureus N315 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|196620.1.peg.1138 Staphylococcus aureus subsp. aureus MW2 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|196620.5.peg.1196 Staphylococcus aureus subsp. aureus MW2 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|282458.1.peg.1160 Staphylococcus aureus subsp. aureus MRSA252 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|282458.4.peg.1234 Staphylococcus aureus subsp. aureus MRSA252 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|282459.1.peg.1182 Staphylococcus aureus subsp. aureus MSSA476 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|282459.5.peg.1238 Staphylococcus aureus subsp. aureus MSSA476 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|359786.13.peg.1395 Staphylococcus aureus subsp. aureus JH9 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|359787.11.peg.1375 Staphylococcus aureus subsp. aureus JH1 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|359787.3.peg.676 Staphylococcus aureus subsp. aureus JH1 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|367830.3.peg.560 Staphylococcus aureus subsp. aureus USA300 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|418127.4.peg.1151 Staphylococcus aureus subsp. aureus Mu3 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|418127.6.peg.1269 Staphylococcus aureus subsp. aureus Mu3 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|426430.6.peg.1130 Staphylococcus aureus subsp. aureus str. Newman FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|426430.8.peg.1271 Staphylococcus aureus subsp. aureus str. Newman FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|450394.6.peg.486 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|451515.3.peg.1259 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|451516.9.peg.1263 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|452948.4.peg.293 Staphylococcus aureus 930918-3 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|455227.3.peg.102 Staphylococcus aureus D30 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|505321.3.peg.1115 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|546342.3.peg.1163 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|546343.3.peg.2101 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|548470.3.peg.110 Staphylococcus aureus subsp. aureus MN8 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|548473.3.peg.2097 Staphylococcus aureus subsp. aureus TCH60 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|548474.3.peg.1057 Staphylococcus aureus subsp. aureus TCH130 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|548475.3.peg.169 Staphylococcus aureus subsp. aureus TCH70 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|553565.3.peg.1543 Staphylococcus aureus A5937 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|553567.3.peg.2061 Staphylococcus aureus A5948 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|553568.3.peg.1737 Staphylococcus aureus A6224 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|553571.3.peg.2624 Staphylococcus aureus A6300 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|553573.3.peg.2452 Staphylococcus aureus A8115 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|553574.3.peg.96 Staphylococcus aureus A8117 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|553577.3.peg.482 Staphylococcus aureus A8796 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|553580.3.peg.1338 Staphylococcus aureus A8819 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|553581.3.peg.943 Staphylococcus aureus A9299 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|553588.3.peg.2009 Staphylococcus aureus A9719 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|553590.4.peg.306 Staphylococcus aureus A9754 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|553592.3.peg.2241 Staphylococcus aureus A9763 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|553596.3.peg.2623 Staphylococcus aureus A9781 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|553601.3.peg.1178 Staphylococcus aureus A10102 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|585143.3.peg.1788 Staphylococcus aureus subsp. aureus 55/2053 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|585144.3.peg.1174 Staphylococcus aureus subsp. aureus 58-424 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|585145.3.peg.2219 Staphylococcus aureus subsp. aureus 65-1322 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|585146.3.peg.1833 Staphylococcus aureus subsp. aureus 68-397 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|585147.3.peg.826 Staphylococcus aureus subsp. aureus A017934/97 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|585148.3.peg.744 Staphylococcus aureus subsp. aureus Btn1260 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|585149.6.peg.1344 Staphylococcus aureus subsp. aureus C101 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|585150.3.peg.2220 Staphylococcus aureus subsp. aureus C160 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|585151.3.peg.1169 Staphylococcus aureus subsp. aureus C427 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|585152.3.peg.1223 Staphylococcus aureus subsp. aureus D139 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|585153.3.peg.2333 Staphylococcus aureus subsp. aureus E1410 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|585154.3.peg.1485 Staphylococcus aureus subsp. aureus EMRSA16 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|585155.3.peg.1435 Staphylococcus aureus subsp. aureus H19 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|585156.3.peg.726 Staphylococcus aureus subsp. aureus M1015 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|585157.3.peg.977 Staphylococcus aureus subsp. aureus M809 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|585158.3.peg.1700 Staphylococcus aureus subsp. aureus M876 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|585159.3.peg.1306 Staphylococcus aureus subsp. aureus M899 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|585160.3.peg.721 Staphylococcus aureus subsp. aureus WBG10049 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|585161.3.peg.1113 Staphylococcus aureus subsp. aureus WW2703/97 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|585891.3.peg.1286 Staphylococcus aureus subsp. aureus Mu50-omega FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|644279.4.peg.1334 Staphylococcus aureus subsp. aureus 132 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|680649.3.peg.132 Staphylococcus aureus subsp. aureus MR1 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|681288.4.peg.1232 Staphylococcus aureus subsp. aureus ED98 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|703339.3.peg.1231 Staphylococcus aureus 04-02981 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|762962.3.peg.801 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|93061.3.peg.1175 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|93061.5.peg.1125 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   GTP-sensing transcriptional pleiotropic repressor CodY
fig|93062.4.peg.1761 Staphylococcus aureus subsp. aureus COL FIG   GTP-sensing transcriptional pleiotropic repressor CodY
gb|AAW38104.1 Staphylococcus aureus subsp. aureus COL     transcriptional regulator CodY
gb|ABD22108.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     GTP-sensing transcriptional pleiotropic repressor CodY
gb|ABD30331.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ49112.1 Staphylococcus aureus subsp. aureus JH9     GTP-sensing transcriptional pleiotropic repressor CodY
gb|ABR52191.1 Staphylococcus aureus subsp. aureus JH1     GTP-sensing transcriptional pleiotropic repressor CodY
gb|ABX29201.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     CodY family transcriptional regulator
gb|EEI94847.1 Staphylococcus aureus subsp. aureus MN8     transcriptional repressor CodY
gb|EEJ61179.1 Staphylococcus aureus subsp. aureus TCH60     transcriptional repressor CodY
gb|EES54818.1 Staphylococcus aureus subsp. aureus TCH70     transcriptional repressor CodY
gb|EES93013.1 Staphylococcus aureus subsp. aureus USA300_TCH959     transcriptional repressor CodY
gb|EES97290.1 Staphylococcus aureus subsp. aureus TCH130     transcriptional repressor CodY
gb|EEV03904.1 Staphylococcus aureus subsp. aureus 55/2053     GTP-sensing transcriptional pleiotropic repressor CodY
gb|EEV06298.1 Staphylococcus aureus subsp. aureus 65-1322     GTP-sensing transcriptional pleiotropic repressor CodY
gb|EEV09350.1 Staphylococcus aureus subsp. aureus 68-397     transcriptional repressor CodY
gb|EEV11593.1 Staphylococcus aureus subsp. aureus E1410     transcriptional repressor CodY
gb|EEV14607.1 Staphylococcus aureus subsp. aureus M876     GTP-sensing transcriptional pleiotropic repressor CodY
gb|EEV28001.1 Staphylococcus aureus A9781     GTP-sensing transcriptional pleiotropic repressor CodY
gb|EEV63723.1 Staphylococcus aureus A9763     transcriptional repressor CodY
gb|EEV66786.1 Staphylococcus aureus A9719     GTP-sensing transcriptional pleiotropic repressor CodY
gb|EEV73174.1 Staphylococcus aureus A9299     transcriptional repressor CodY
gb|EEV74039.1 Staphylococcus aureus A8115     transcriptional repressor CodY
gb|EEV76724.1 Staphylococcus aureus A6300     transcriptional repressor CodY
gb|EEV80302.1 Staphylococcus aureus A6224     transcriptional repressor CodY
gb|EEV82614.1 Staphylococcus aureus A5948     GTP-sensing transcriptional pleiotropic repressor CodY
gb|EEV85942.1 Staphylococcus aureus A5937     transcriptional repressor CodY
gb|EEW45713.1 Staphylococcus aureus 930918-3     transcriptional repressor CodY
gb|EEW48270.1 Staphylococcus aureus D30     transcriptional repressor CodY
gi|123003473 organism not parsed/found in ncbi nr NCBI   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
gi|123722398 organism not parsed/found in ncbi nr NCBI   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
gi|13701055 Staphylococcus aureus subsp. aureus N315 NCBI   transcription pleiotropic repressor codY
gi|14247025 Staphylococcus aureus subsp. aureus Mu50 NCBI   transcription pleiotropic repressor
gi|147740814 Staphylococcus aureus subsp. aureus JH9 NCBI   GTP-sensing transcriptional pleiotropic repressor CodY
gi|148267745 Staphylococcus aureus subsp. aureus JH9 NCBI   transcriptional repressor CodY
gi|149946255 Staphylococcus aureus subsp. aureus JH1 NCBI   GTP-sensing transcriptional pleiotropic repressor CodY
gi|150374177 Staphylococcus aureus subsp. aureus str. Newman NCBI   GTP-sensing transcriptional pleiotropic repressor CodY
gi|150393803 Staphylococcus aureus subsp. aureus JH1 NCBI   transcriptional repressor CodY
gi|151221377 Staphylococcus aureus subsp. aureus str. Newman NCBI   transcriptional repressor CodY
gi|156721711 Staphylococcus aureus subsp. aureus Mu3 NCBI   transcription pleiotropic repressor
gi|156979576 Staphylococcus aureus subsp. aureus Mu3 NCBI   transcriptional repressor CodY
gi|15924245 Staphylococcus aureus subsp. aureus Mu50 NCBI   transcriptional repressor CodY
gi|15926838 Staphylococcus aureus subsp. aureus N315 NCBI   transcriptional repressor CodY
gi|160368230 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   CodY family transcriptional regulator
gi|161509421 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   transcriptional repressor CodY
gi|166218408 organism not parsed/found in ncbi nr NCBI   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
gi|172048865 organism not parsed/found in ncbi nr NCBI   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
gi|189082665 organism not parsed/found in ncbi nr NCBI   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
gi|189082666 organism not parsed/found in ncbi nr NCBI   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
gi|189082667 organism not parsed/found in ncbi nr NCBI   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
gi|21204306 Staphylococcus aureus subsp. aureus MW2 NCBI   transcription pleiotropic repressor codY
gi|21282867 Staphylococcus aureus subsp. aureus MW2 NCBI   transcriptional repressor CodY
gi|221138161 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   transcriptional repressor CodY
gi|221142045 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   transcriptional repressor CodY
gi|227245088 Staphylococcus aureus subsp. aureus MN8 NCBI   transcriptional repressor CodY
gi|227558527 Staphylococcus aureus subsp. aureus MN8 NCBI   transcriptional repressor CodY
gi|227851381 Staphylococcus aureus subsp. aureus TCH60 NCBI   transcriptional repressor CodY
gi|227900318 Staphylococcus aureus subsp. aureus TCH60 NCBI   transcriptional repressor CodY
gi|251802161 Staphylococcus aureus subsp. aureus TCH70 NCBI   transcriptional repressor CodY
gi|251814166 Staphylococcus aureus subsp. aureus TCH70 NCBI   transcriptional repressor CodY
gi|253315611 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   transcriptional repressor CodY
gi|253724284 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   transcriptional repressor CodY
gi|253728561 Staphylococcus aureus subsp. aureus TCH130 NCBI   transcriptional repressor CodY
gi|253731874 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   transcriptional repressor CodY
gi|253733507 Staphylococcus aureus subsp. aureus TCH130 NCBI   transcriptional repressor CodY
gi|255006042 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   transcriptional repressor CodY
gi|257271766 Staphylococcus aureus subsp. aureus 55/2053 NCBI   GTP-sensing transcriptional pleiotropic repressor CodY
gi|257274811 Staphylococcus aureus subsp. aureus 65-1322 NCBI   GTP-sensing transcriptional pleiotropic repressor CodY
gi|257278731 Staphylococcus aureus subsp. aureus 68-397 NCBI   transcriptional repressor CodY
gi|257281456 Staphylococcus aureus subsp. aureus E1410 NCBI   transcriptional repressor CodY
gi|257284487 Staphylococcus aureus subsp. aureus M876 NCBI   GTP-sensing transcriptional pleiotropic repressor CodY
gi|257425309 Staphylococcus aureus subsp. aureus 55/2053 NCBI   GTP-sensing transcriptional pleiotropic repressor CodY
gi|257427970 Staphylococcus aureus subsp. aureus 65-1322 NCBI   GTP-sensing transcriptional pleiotropic repressor CodY
gi|257430603 Staphylococcus aureus subsp. aureus 68-397 NCBI   transcriptional repressor CodY
gi|257433363 Staphylococcus aureus subsp. aureus E1410 NCBI   transcriptional repressor CodY
gi|257436205 Staphylococcus aureus subsp. aureus M876 NCBI   GTP-sensing transcriptional pleiotropic repressor CodY
gi|257789661 Staphylococcus aureus A9781 NCBI   GTP-sensing transcriptional pleiotropic repressor CodY
gi|257795689 Staphylococcus aureus A9781 NCBI   GTP-sensing transcriptional pleiotropic repressor CodY
gi|257839249 Staphylococcus aureus A9763 NCBI   transcriptional repressor CodY
gi|257842361 Staphylococcus aureus A9719 NCBI   GTP-sensing transcriptional pleiotropic repressor CodY
gi|257849192 Staphylococcus aureus A9299 NCBI   transcriptional repressor CodY
gi|257850086 Staphylococcus aureus A8115 NCBI   transcriptional repressor CodY
gi|257853765 Staphylococcus aureus A6300 NCBI   transcriptional repressor CodY
gi|257857404 Staphylococcus aureus A6224 NCBI   transcriptional repressor CodY
gi|257859772 Staphylococcus aureus A5948 NCBI   GTP-sensing transcriptional pleiotropic repressor CodY
gi|257863178 Staphylococcus aureus A5937 NCBI   transcriptional repressor CodY
gi|258415913 Staphylococcus aureus A9763 NCBI   transcriptional repressor CodY
gi|258421675 Staphylococcus aureus A9719 NCBI   GTP-sensing transcriptional pleiotropic repressor CodY
gi|258434831 Staphylococcus aureus A9299 NCBI   transcriptional repressor CodY
gi|258444593 Staphylococcus aureus A8115 NCBI   transcriptional repressor CodY
gi|258447574 Staphylococcus aureus A6300 NCBI   transcriptional repressor CodY
gi|258449416 Staphylococcus aureus A6224 NCBI   transcriptional repressor CodY
gi|258452554 Staphylococcus aureus A5948 NCBI   GTP-sensing transcriptional pleiotropic repressor CodY
gi|258454795 Staphylococcus aureus A5937 NCBI   transcriptional repressor CodY
gi|259160692 Staphylococcus aureus 930918-3 NCBI   transcriptional repressor CodY
gi|259163715 Staphylococcus aureus D30 NCBI   transcriptional repressor CodY
gi|49241547 Staphylococcus aureus subsp. aureus MRSA252 NCBI   putative regulatory protein
gi|49244537 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative regulatory protein
gi|49483418 Staphylococcus aureus subsp. aureus MRSA252 NCBI   transcriptional repressor CodY
gi|49486094 Staphylococcus aureus subsp. aureus MSSA476 NCBI   transcriptional repressor CodY
gi|54036882 organism not parsed/found in ncbi nr NCBI   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
gi|54036883 organism not parsed/found in ncbi nr NCBI   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
gi|54040912 organism not parsed/found in ncbi nr NCBI   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
gi|57286010 Staphylococcus aureus subsp. aureus COL NCBI   transcriptional regulator CodY
gi|57651824 Staphylococcus aureus subsp. aureus COL NCBI   transcriptional repressor CodY
gi|61212587 organism not parsed/found in ncbi nr NCBI   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
gi|61212591 organism not parsed/found in ncbi nr NCBI   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
gi|68052045 organism not parsed/found in ncbi nr NCBI   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
gi|87127594 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   GTP-sensing transcriptional pleiotropic repressor CodY
gi|87161620 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   transcriptional repressor CodY
gi|87202521 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194963 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   transcriptional repressor CodY
img|637092753 Staphylococcus aureus aureus N315 IMG   transcriptional repressor CodY
img|637099767 Staphylococcus aureus aureus Mu50 IMG   transcriptional repressor CodY
img|637152030 Staphylococcus aureus aureus COL IMG   transcriptional repressor CodY
img|637154667 Staphylococcus aureus aureus MRSA252 IMG   transcriptional repressor CodY
img|637157419 Staphylococcus aureus aureus MSSA476 IMG   transcriptional repressor CodY
img|637298902 Staphylococcus aureus aureus MW2 IMG   transcriptional repressor CodY
img|637887800 Staphylococcus aureus aureus USA300 IMG   GTP-sensing transcriptional pleiotropic repressor CodY
img|637893857 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639109977 Staphylococcus aureus aureus JH1 IMG   GTP-sensing transcriptional pleiotropic repressor CodY
img|640565664 Staphylococcus aureus aureus JH9 IMG   GTP-sensing transcriptional pleiotropic repressor CodY
img|640779425 Staphylococcus aureus aureus JH1 IMG   GTP-sensing transcriptional pleiotropic repressor CodY
img|640795546 Staphylococcus aureus aureus Newman IMG   GTP-sensing transcriptional pleiotropic repressor CodY
img|640903989 Staphylococcus aureus aureus Mu3 IMG   transcription pleiotropic repressor
img|641309152 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   CodY family transcriptional regulator
kegg|saa:SAUSA300_1148 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   transcriptional repressor CodY
kegg|sac:SACOL1272 Staphylococcus aureus subsp. aureus COL KEGG   transcriptional repressor CodY
kegg|sae:NWMN_1165 Staphylococcus aureus subsp. aureus Newman KEGG   transcriptional repressor CodY
kegg|sah:SaurJH1_1340 Staphylococcus aureus subsp. aureus JH1 KEGG   transcriptional repressor CodY
kegg|saj:SaurJH9_1315 Staphylococcus aureus subsp. aureus JH9 KEGG   transcriptional repressor CodY
kegg|sam:MW1138 Staphylococcus aureus subsp. aureus MW2 KEGG   transcriptional repressor CodY
kegg|sao:SAOUHSC_01228 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   transcriptional repressor CodY
kegg|sar:SAR1231   KEGG   transcriptional repressor CodY
kegg|sas:SAS1189   KEGG   transcriptional repressor CodY
kegg|sau:SA1098   KEGG   transcriptional repressor CodY
kegg|sav:SAV1255   KEGG   transcriptional repressor CodY
kegg|saw:SAHV_1245 Staphylococcus aureus subsp. aureus Mu3 KEGG   transcriptional repressor CodY
kegg|sax:USA300HOU_1186 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   transcriptional repressor CodY
ref|NP_371779.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   transcriptional repressor CodY
ref|NP_374371.1 Staphylococcus aureus subsp. aureus N315 RefSeq   transcriptional repressor CodY
ref|NP_645955.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   transcriptional repressor CodY
ref|YP_001246688.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   transcriptional repressor CodY
ref|YP_001316478.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   transcriptional repressor CodY
ref|YP_001332199.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   transcriptional repressor CodY
ref|YP_001441835.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   transcriptional repressor CodY
ref|YP_001575080.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   transcriptional repressor CodY
ref|YP_040642.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   transcriptional repressor CodY
ref|YP_043315.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   transcriptional repressor CodY
ref|YP_186130.1 Staphylococcus aureus subsp. aureus COL RefSeq   transcriptional repressor CodY
ref|YP_493845.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   transcriptional repressor CodY
ref|YP_499763.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   transcriptional repressor CodY
ref|ZP_03562963.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   transcriptional repressor CodY
ref|ZP_03566538.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   transcriptional repressor CodY
ref|ZP_03988574.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   transcriptional repressor CodY
ref|ZP_04018123.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   transcriptional repressor CodY
ref|ZP_04828639.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   transcriptional repressor CodY
ref|ZP_04838824.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   transcriptional repressor CodY
ref|ZP_04866039.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   transcriptional repressor CodY
ref|ZP_04867672.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   transcriptional repressor CodY
ref|ZP_05144643.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   transcriptional repressor CodY
ref|ZP_05601734.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   GTP-sensing transcriptional pleiotropic repressor CodY
ref|ZP_05604368.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   GTP-sensing transcriptional pleiotropic repressor CodY
ref|ZP_05606985.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   transcriptional repressor CodY
ref|ZP_05609721.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   transcriptional repressor CodY
ref|ZP_05612252.1 Staphylococcus aureus subsp. aureus M876 RefSeq   GTP-sensing transcriptional pleiotropic repressor CodY
ref|ZP_05644668.1 Staphylococcus aureus A9781 RefSeq   GTP-sensing transcriptional pleiotropic repressor CodY
ref|ZP_05682183.1 Staphylococcus aureus A9763 RefSeq   transcriptional repressor CodY
ref|ZP_05684599.1 Staphylococcus aureus A9719 RefSeq   GTP-sensing transcriptional pleiotropic repressor CodY
ref|ZP_05688905.1 Staphylococcus aureus A9299 RefSeq   transcriptional repressor CodY
ref|ZP_05692922.1 Staphylococcus aureus A8115 RefSeq   transcriptional repressor CodY
ref|ZP_05695718.1 Staphylococcus aureus A6300 RefSeq   transcriptional repressor CodY
ref|ZP_05697519.1 Staphylococcus aureus A6224 RefSeq   transcriptional repressor CodY
ref|ZP_05700560.1 Staphylococcus aureus A5948 RefSeq   GTP-sensing transcriptional pleiotropic repressor CodY
ref|ZP_05702759.1 Staphylococcus aureus A5937 RefSeq   transcriptional repressor CodY
sp|A5ISD9 Staphylococcus aureus (strain JH9) SwissProt   GTP-sensing transcriptional pleiotropic repressor codY
sp|A6QGF5 Staphylococcus aureus (strain Newman) SwissProt   GTP-sensing transcriptional pleiotropic repressor codY
sp|A6U173 Staphylococcus aureus (strain JH1) SwissProt   GTP-sensing transcriptional pleiotropic repressor codY
sp|A7X1N2 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   GTP-sensing transcriptional pleiotropic repressor codY
sp|A8Z3T5 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   GTP-sensing transcriptional pleiotropic repressor codY
sp|CODY_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
sp|CODY_STAA2 organism not parsed/found in ncbi nr SwissProt   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
sp|CODY_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
sp|CODY_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
sp|CODY_STAA9 organism not parsed/found in ncbi nr SwissProt   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
sp|CODY_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
sp|CODY_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
sp|CODY_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
sp|CODY_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
sp|CODY_STAAR organism not parsed/found in ncbi nr SwissProt   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
sp|CODY_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
sp|CODY_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
sp|CODY_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=GTP-sensing transcriptional pleiotropic repressor codY
sp|P63843 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   GTP-sensing transcriptional pleiotropic repressor codY
sp|P63844 Staphylococcus aureus (strain N315) SwissProt   GTP-sensing transcriptional pleiotropic repressor codY
sp|P63845 Staphylococcus aureus (strain MW2) SwissProt   GTP-sensing transcriptional pleiotropic repressor codY
sp|Q2FHI3 Staphylococcus aureus (strain USA300) SwissProt   GTP-sensing transcriptional pleiotropic repressor codY
sp|Q2FZ27 Staphylococcus aureus (strain NCTC 8325) SwissProt   GTP-sensing transcriptional pleiotropic repressor codY
sp|Q5HGH7 Staphylococcus aureus (strain COL) SwissProt   GTP-sensing transcriptional pleiotropic repressor codY
sp|Q6G9V8 Staphylococcus aureus (strain MSSA476) SwissProt   GTP-sensing transcriptional pleiotropic repressor codY
sp|Q6GHI0 Staphylococcus aureus (strain MRSA252) SwissProt   GTP-sensing transcriptional pleiotropic repressor codY
tr|C2GCP0 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   Transcriptional repressor CodY
tr|C2K8Y4 Staphylococcus aureus subsp. aureus MN8 TrEMBL   Transcriptional repressor CodY
tr|C5N4Z7 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Transcriptional repressor CodY
tr|C5Q0K3 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Transcriptional repressor CodY
tr|C5QIM3 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Transcriptional repressor CodY


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
13 fig|93062.19.peg.1239 DNA topoisomerase I (EC 5.99.1.2)
11 fig|93062.19.peg.1240 Methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))-methyltransferase TrmFO (EC 2.1.1.74)
7 fig|93062.19.peg.1241 Site-specific tyrosine recombinase
9 fig|93062.19.peg.1242 ATP-dependent protease subunit HslV (EC 3.4.25.2)
12 fig|93062.19.peg.1243 ATP-dependent hsl protease ATP-binding subunit HslU
6 fig|93062.19.peg.1247 Uridylate kinase (EC 2.7.4.22)
8 fig|93062.19.peg.1248 Ribosome recycling factor
8 fig|93062.19.peg.1249 Undecaprenyl diphosphate synthase (EC 2.5.1.31)
6 fig|93062.19.peg.1250 Phosphatidate cytidylyltransferase (EC 2.7.7.41)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search