The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.1152: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: FIG01107944: hypothetical protein
Translate Function Assignments



Context on contig NC_002951 from base 1177385 to 1189081 (11697 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1141 1177385 1177735 351 +           Involved in expression of fibrinogen binding protein locus|SACOL1169, protein_id|YP_186032.1, gi|57650268, geneID|3238697
1142 1178052 1178294 243 + 316         FIG01108361: hypothetical protein  
1144 1178322 1178432 111 + 27         hypothetical protein  
1145 1178742 1178557 186 - 124         FIG01107916: hypothetical protein locus|SACOL1171, protein_id|YP_186034.1, gi|57650270, geneID|3238139
1146 1179200 1178952 249 - 209         FIG01108338: hypothetical protein  
1147 1179597 1179364 234 - 163         FIG01108519: hypothetical protein locus|SACOL1172, protein_id|YP_186035.1, gi|57650271, geneID|3238597
1148 1181033 1180074 960 - 476         Alpha-hemolysin precursor gene_name|hlY, locus|SACOL1173, protein_id|YP_186036.1, gi|57650272, geneID|3237999
1149 1181706 1181852 147 + 672         Doubtful CDS. No database matches locus|SACOL1174, protein_id|YP_186037.1, gi|57650273, geneID|3238304
1150 1181809 1182033 225 + -44         FIG01108126: hypothetical protein locus|SACOL1175, protein_id|YP_186038.1, gi|57650274, geneID|3238126
1151 1182242 1182421 180 + 208         hypothetical protein locus|SACOL1177, protein_id|YP_186040.1, gi|57650276, geneID|3238517
1152 1183306 1182590 717 - 168         FIG01107944: hypothetical protein locus|SACOL1178, protein_id|YP_186041.1, gi|57650277, geneID|3238464
1153 1184139 1183414 726 - 107         FIG01107880: hypothetical protein locus|SACOL1179, protein_id|YP_186042.1, gi|57650278, geneID|3238522
1154 1184959 1184234 726 - 94         FIG01108191: hypothetical protein locus|SACOL1180, protein_id|YP_186043.1, gi|57650279, geneID|3238179
1155 1185397 1186398 1002 + 437     4: 5 1 2 6   Ornithine carbamoyltransferase (EC 2.1.3.3) gene_name|arcB1, locus|SACOL1181, protein_id|YP_186044.1, gi|57650280, geneID|3238259
1156 1186421 1187353 933 + 22     3: 3 1 2   Carbamate kinase (EC 2.7.2.2) gene_name|arcC1, locus|SACOL1182, protein_id|YP_186045.1, gi|57650281, geneID|3238413
1157 1187525 1189081 1557 + 171     4: 3 1 2 4   Arginine/ornithine antiporter ArcD locus|SACOL1183, protein_id|YP_186046.1, gi|57650282, geneID|3238125

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93062.19.peg.1152 FIG01107944: hypothetical protein
MSKNITKNIILTTTLLLLGTVLPQNQKPVFSFYSEAKAYSIGQDETNINELIKYYTQPHF
SFSNKWLYQYDNGNIYVELKRYSWSAHISLWGAESWGNINQLKDRYVDVFGLKDKDTDQL
WWSYRETFTGGVTPAAKPSDKTYNLFVQYKDKLQTIIGAHKIYQGNKPVLTLKEIDFRAR
EALIKNKILYNENRNKGKLKITGGGNNYTIDLSKRLHSDLANVYVKNPNKITVDVLFD

MD5 = 705110deba2cd37fd954dde3a026d845


  DNA Sequence

>fig|93062.19.peg.1152 FIG01107944: hypothetical protein
atgagtaagaacatcacgaaaaatataattttaacgacaacattattactattaggtact
gtattacctcaaaatcaaaaaccagtatttagtttttactctgaagctaaagcttatagc
attggtcaagatgaaactaacatcaatgaattaattaaatattacacacagcctcatttt
tcattttcaaataaatggctatatcaatatgataatggaaacatttatgttgaacttaag
agatattcatggtcagcacatatatctttatggggcgctgaaagttggggaaatattaat
cagttaaaagatcgttacgtagatgtgtttggactaaaagacaaagatactgatcagtta
tggtggtcttatagagagacatttacaggtggcgttacaccagccgcaaaaccttctgat
aaaacttataatctttttgtgcaatacaaagataaactacaaacgattattggtgcgcat
aaaatataccaaggcaataaaccagtattaacattgaaagaaatcgatttccgtgcacga
gaagcgttaataaaaaataaaatattatataacgaaaatcgtaataaaggtaagcttaag
atcaccggtggcggtaataactacactattgatttaagcaaaagattacattcagatcta
gcaaatgtttatgttaaaaatcctaataaaataactgttgacgtcctctttgattag


  DNA with Flanking Sequence

>fig|93062.19.peg.1152 FIG01107944: hypothetical protein
ataaaagaccaagaaaccattgattcttttgcattatctcaagaaacgtttactggtggt
gttactcctgcagcaacatctaacgataaacactataaactgaatgtaacatataaagat
aaagcagaaacgtttactggcggatttccagtttatgaaggcaataagcctgttttaact
ttaaaagaattagattttcgtattcgtcaaacattaattaaaagtaaaaaattatataat
aattcttataataaaggacaaattaaaataacaggtgcagacaataactacacaatagat
ttaagtaaaaggttgccatcaactgatgcaaatagatatgttaaaaaacctcaaaatgca
aaaattgaagttatcctcgaaaaatcaaactaacaataataatggagttaataaaaataa
tcgcaaatactatattgacttcgctcacatttaaatttcttattcctcgtatcatgattc
ctctgaaaggagatgttctaatgagtaagaacatcacgaaaaatataattttaacgacaa
cattattactattaggtactgtattacctcaaaatcaaaaaccagtatttagtttttact
ctgaagctaaagcttatagcattggtcaagatgaaactaacatcaatgaattaattaaat
attacacacagcctcatttttcattttcaaataaatggctatatcaatatgataatggaa
acatttatgttgaacttaagagatattcatggtcagcacatatatctttatggggcgctg
aaagttggggaaatattaatcagttaaaagatcgttacgtagatgtgtttggactaaaag
acaaagatactgatcagttatggtggtcttatagagagacatttacaggtggcgttacac
cagccgcaaaaccttctgataaaacttataatctttttgtgcaatacaaagataaactac
aaacgattattggtgcgcataaaatataccaaggcaataaaccagtattaacattgaaag
aaatcgatttccgtgcacgagaagcgttaataaaaaataaaatattatataacgaaaatc
gtaataaaggtaagcttaagatcaccggtggcggtaataactacactattgatttaagca
aaagattacattcagatctagcaaatgtttatgttaaaaatcctaataaaataactgttg
acgtcctctttgattagtatatgaaggtgacttatacttcatgcactttaattccaaatc
agattatttaaatgataatttttaaagtgtatgatgtatataataggtaaaattttctat
atatttaaatggaattgggagtaggaatgtgacagaaatagtattttataaaatttattt
cgttgtcactccccaacttgcacattattgtaagctgactttccgccagcttctatgttg
gggccccgccaacttgcattgtctgtagaaattgggaatccaatttcactatgttggggc
cccgccaacttgcacattattgtaagctgacttttcgtcagcttctgtgttggggcccac
cccaacttgcattgtctgtagaatttctttttgaaattctctatgttggggccccgccta
taattgaaaaatgcttgttacatgggcattttcattcggtcaactactaccaatataata
ttgtagagcctaagacattgatttattatgtcttagg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005576       C:extracellular region
GO:0009405       P:pathogenesis
cmr|NT05SA1010 Staphylococcus aureus NCTC 8325     exotoxin
cmr|SACOL1178 Staphylococcus aureus subsp. aureus COL     exotoxin 1, putative
cmr|SAUSA300_1059 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative exotoxin 1
dbj|BAF67347.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.2488 Staphylococcus aureus subsp. aureus USA300 FIG   FIG01107944: hypothetical protein
fig|426430.6.peg.1044 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01107944: hypothetical protein
fig|426430.8.peg.1179 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01107944: hypothetical protein
fig|451515.3.peg.1167 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   FIG01107944: hypothetical protein
fig|451516.9.peg.1171 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01107944: hypothetical protein
fig|452948.4.peg.683 Staphylococcus aureus 930918-3 FIG   FIG01107944: hypothetical protein
fig|455227.3.peg.725 Staphylococcus aureus D30 FIG   FIG01107944: hypothetical protein
fig|546342.3.peg.2488 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   FIG01107944: hypothetical protein
fig|546343.3.peg.675 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   FIG01107944: hypothetical protein
fig|553567.3.peg.1360 Staphylococcus aureus A5948 FIG   FIG01107944: hypothetical protein
fig|553590.4.peg.215 Staphylococcus aureus A9754 FIG   FIG01107944: hypothetical protein
fig|553594.3.peg.79 Staphylococcus aureus A9765 FIG   FIG01107944: hypothetical protein
fig|644279.4.peg.1177 Staphylococcus aureus subsp. aureus 132 FIG   FIG01107944: hypothetical protein
fig|93061.3.peg.1080 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01107944: hypothetical protein
fig|93061.5.peg.1032 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01107944: hypothetical protein
fig|93062.4.peg.1545 Staphylococcus aureus subsp. aureus COL FIG   FIG01107944: hypothetical protein
gb|AAW36557.1 Staphylococcus aureus subsp. aureus COL     exotoxin 1, putative
gb|ABD21604.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative exotoxin 1
gb|ABD30236.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX29120.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     exotoxin
gb|EEV83297.1 Staphylococcus aureus A5948     superantigen-like protein
gb|EEW45461.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1528
gb|EEW47759.1 Staphylococcus aureus D30     hypothetical protein SAD30_1573
gi|150374087 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151221287 Staphylococcus aureus subsp. aureus str. Newman NCBI   superantigen-like protein
gi|160368149 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   exotoxin
gi|161509340 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   superantigen-like protein
gi|221139438 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   superantigen-like protein
gi|221140663 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   superantigen-like protein
gi|257860470 Staphylococcus aureus A5948 NCBI   superantigen-like protein
gi|258451862 Staphylococcus aureus A5948 NCBI   superantigen-like protein
gi|259160436 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1528
gi|259163199 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1573
gi|57284463 Staphylococcus aureus subsp. aureus COL NCBI   exotoxin 1, putative
gi|57650277 Staphylococcus aureus subsp. aureus COL NCBI   superantigen-like protein
gi|87127090 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative exotoxin 1
gi|87161116 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   superantigen-like protein
gi|87202426 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194868 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   superantigen-like protein
img|637151940 Staphylococcus aureus aureus COL IMG   exotoxin 1, putative
img|637887711 Staphylococcus aureus aureus USA300 IMG   putative exotoxin 1
img|637893761 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640795455 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641309070 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   exotoxin
img|641771237 Staphylococcus aureus aureus USA300_TCH959 IMG   exotoxin
kegg|saa:SAUSA300_1059 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   superantigen-like protein
kegg|sac:SACOL1178 Staphylococcus aureus subsp. aureus COL KEGG   superantigen-like protein
kegg|sae:NWMN_1075 Staphylococcus aureus subsp. aureus Newman KEGG   superantigen-like protein
kegg|sao:SAOUHSC_01124 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   superantigen-like protein
kegg|sax:USA300HOU_1103 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   superantigen-like protein
ref|YP_001332109.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   superantigen-like protein
ref|YP_001574999.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   superantigen-like protein
ref|YP_186041.1 Staphylococcus aureus subsp. aureus COL RefSeq   superantigen-like protein
ref|YP_493757.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   superantigen-like protein
ref|YP_499668.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   superantigen-like protein
ref|ZP_03564237.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   superantigen-like protein
ref|ZP_03565156.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   superantigen-like protein
ref|ZP_05699883.1 Staphylococcus aureus A5948 RefSeq   superantigen-like protein
tr|A6QG65 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z1U7 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Exotoxin
tr|Q2FHS1 Staphylococcus aureus (strain USA300) TrEMBL   Putative exotoxin 1
tr|Q2FZB3 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HGR6 Staphylococcus aureus (strain COL) TrEMBL   Exotoxin 1, putative


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search