The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.1150: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: FIG01108126: hypothetical protein
Translate Function Assignments



Context on contig NC_002951 from base 1176734 to 1187353 (10620 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1140 1176734 1177231 498 +       1: 3   Extracellular fibrinogen-binding protein Efb gene_name|efb, locus|SACOL1168, protein_id|YP_186031.1, gi|57650267, geneID|3238454
1141 1177385 1177735 351 + 153         Involved in expression of fibrinogen binding protein locus|SACOL1169, protein_id|YP_186032.1, gi|57650268, geneID|3238697
1142 1178052 1178294 243 + 316         FIG01108361: hypothetical protein  
1144 1178322 1178432 111 + 27         hypothetical protein  
1145 1178742 1178557 186 - 124         FIG01107916: hypothetical protein locus|SACOL1171, protein_id|YP_186034.1, gi|57650270, geneID|3238139
1146 1179200 1178952 249 - 209         FIG01108338: hypothetical protein  
1147 1179597 1179364 234 - 163         FIG01108519: hypothetical protein locus|SACOL1172, protein_id|YP_186035.1, gi|57650271, geneID|3238597
1148 1181033 1180074 960 - 476         Alpha-hemolysin precursor gene_name|hlY, locus|SACOL1173, protein_id|YP_186036.1, gi|57650272, geneID|3237999
1149 1181706 1181852 147 + 672         Doubtful CDS. No database matches locus|SACOL1174, protein_id|YP_186037.1, gi|57650273, geneID|3238304
1150 1181809 1182033 225 + -44         FIG01108126: hypothetical protein locus|SACOL1175, protein_id|YP_186038.1, gi|57650274, geneID|3238126
1151 1182242 1182421 180 + 208         hypothetical protein locus|SACOL1177, protein_id|YP_186040.1, gi|57650276, geneID|3238517
1152 1183306 1182590 717 - 168         FIG01107944: hypothetical protein locus|SACOL1178, protein_id|YP_186041.1, gi|57650277, geneID|3238464
1153 1184139 1183414 726 - 107         FIG01107880: hypothetical protein locus|SACOL1179, protein_id|YP_186042.1, gi|57650278, geneID|3238522
1154 1184959 1184234 726 - 94         FIG01108191: hypothetical protein locus|SACOL1180, protein_id|YP_186043.1, gi|57650279, geneID|3238179
1155 1185397 1186398 1002 + 437     4: 4 1 2 6   Ornithine carbamoyltransferase (EC 2.1.3.3) gene_name|arcB1, locus|SACOL1181, protein_id|YP_186044.1, gi|57650280, geneID|3238259
1156 1186421 1187353 933 + 22     3: 5 1 2   Carbamate kinase (EC 2.7.2.2) gene_name|arcC1, locus|SACOL1182, protein_id|YP_186045.1, gi|57650281, geneID|3238413

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93062.19.peg.1150 FIG01108126: hypothetical protein
MLIQERGLKMTELNNIINSLQSLFESESGYKISKNSGVPYQTVQDLRNGKTKLEDARFRT
IIKLYSYYVSLKEH

MD5 = a04274a52a750d512a04bdbe22a6c841


  DNA Sequence

>fig|93062.19.peg.1150 FIG01108126: hypothetical protein
ttgttaattcaagaaaggggattaaaaatgacagagttgaataatattataaactctctt
caatctttgtttgagtctgaatcaggctataaaatttcgaaaaattcaggagttccatat
caaacagtacaagatttaagaaatgggaaaaccaaactagaagatgctagatttagaacg
attattaaactttatagttactatgtctcattaaaagaacactaa


  DNA with Flanking Sequence

>fig|93062.19.peg.1150 FIG01108126: hypothetical protein
attgattaatttctttaaaactaatgatttgtttgatttaaaaatgtaatcgattacaat
ataaaaatacaaatatcttagaattaaatcaattaattaactattaaataaaaattaact
atatattaactagtgtaaattaataaatagaaatagagaaaaagggtattaattatgttt
ggaatttcgtcgggaataaattttgccattacatagaaatatctaatagataacgaaaaa
gtatcgtatgtatttttaatatagtgtaaaatattatatgtaaaataaaatgtaggtttt
tagttagaggcattataagaaaattttgagtataggttagcttttaattatgaatcttat
tgaaatttgattaataaaaatatgataggggattaaaatgaaactattttatatcgtatt
tcttattattatatggctgaatatatttttaggaaatgaaatcatccatacactgactgt
tttaataacaacattgtatattgttaattcaagaaaggggattaaaaatgacagagttga
ataatattataaactctcttcaatctttgtttgagtctgaatcaggctataaaatttcga
aaaattcaggagttccatatcaaacagtacaagatttaagaaatgggaaaaccaaactag
aagatgctagatttagaacgattattaaactttatagttactatgtctcattaaaagaac
actaatcatgggacaataaagtattgctataataatttaatcattaaatgaaggaataga
gcctaagacataataaatcaatgtcttaggctctacaatattatattggtagtagttgac
cgaatgaaaatgcccatgtaacaagcatttttcaattataggcggggccccaacatagag
aatttcaaaaagaaattctacagacaatgcaagttggggtgggccccaacacagaagctg
acgaaaagtcagcttacaataatgtgcaagttggcggggccccaacatagtgaaattgga
ttcccaatttctacagacaatgcaagttggcggggccccaacatagaagctggcggaaag
tcagcttacaataatgtgcaagttggggagtgacaacgaaataaattttataaaatacta
tttctgtcacattcctactcccaattccatttaaatatatagaaaattttacctattata
tacatcatacactttaaaaattatc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|359787.11.peg.1282 Staphylococcus aureus subsp. aureus JH1 FIG   FIG01108126: hypothetical protein
fig|418127.6.peg.1177 Staphylococcus aureus subsp. aureus Mu3 FIG   FIG01108126: hypothetical protein
fig|553574.3.peg.4 Staphylococcus aureus A8117 FIG   FIG01108126: hypothetical protein
fig|553596.3.peg.2716 Staphylococcus aureus A9781 FIG   FIG01108126: hypothetical protein
fig|93061.3.peg.1079 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108126: hypothetical protein
gb|ABD30235.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gi|87202425 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194867 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01123
img|637893760 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
kegg|sao:SAOUHSC_01123 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
ref|YP_499667.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01123
tr|Q2FZB4 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search