The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.1092: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: Uncharacterized protein YlaI
Translate Function Assignments



Context on contig NC_002951 from base 1123744 to 1135925 (12182 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1087 1125096 1123744 1353 -         dlit(23817615) Manganese transport protein MntH locus|SACOL1114, protein_id|YP_185978.1, gi|57651714, geneID|3237718
1088 1125894 1125280 615 - 183         FIG01108286: hypothetical protein locus|SACOL1115, protein_id|YP_185979.1, gi|57651715, geneID|3237719
1089 1126051 1126878 828 + 156     3: 5 2 4   Inositol-1-monophosphatase (EC 3.1.3.25) locus|SACOL1116, protein_id|YP_185980.1, gi|57651716, geneID|3237981
1090 1127223 1127032 192 - 153         FIG01107843: hypothetical protein locus|SACOL1117, protein_id|YP_185981.1, gi|57651717, geneID|3237982
1091 1127325 1129172 1848 + 101     1: 6   GTP-binding protein TypA/BipA gene_name|typA, locus|SACOL1118, protein_id|YP_185982.1, gi|57651718, geneID|3237983
1092 1129479 1129312 168 - 139         Uncharacterized protein YlaI locus|SACOL1119, protein_id|YP_185983.1, gi|57651719, geneID|3237984
1093 1129963 1129481 483 - 1         FIG01108239: hypothetical protein locus|SACOL1120, protein_id|YP_185984.1, gi|57651720, geneID|3237985
1094 1130104 1130379 276 + 140       dlit(17469204) UPF0358 protein YlaN locus|SACOL1121, protein_id|YP_185985.1, gi|57651721, geneID|3237986
1095 1130693 1131919 1227 + 313     4: 8 3 7 9   Cell division protein FtsW locus|SACOL1122, protein_id|YP_185986.1, gi|57651722, geneID|3237821
1096 1132473 1135925 3453 + 553     2: 10 1   Pyruvate carboxylase (EC 6.4.1.1) gene_name|pyc, locus|SACOL1123, protein_id|YP_185987.1, gi|57651723, geneID|3237822

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93062.19.peg.1092 Uncharacterized protein YlaI
MRQVQCIICDAKVFIDERTTESKRLKNNPIRTFMCDDCKSRLDTPKQRAQHYPLD

MD5 = b9de5834f653b845ddfb7dd592dd6118


  DNA Sequence

>fig|93062.19.peg.1092 Uncharacterized protein YlaI
ttgagacaagtgcaatgcattatctgtgatgcaaaagtatttatagatgagcgcacaact
gagtctaaacgacttaaaaacaatcctattcgaacatttatgtgtgatgattgtaaaagt
cgattagacacacctaaacaacgtgcgcaacactatccgctcgattaa


  DNA with Flanking Sequence

>fig|93062.19.peg.1092 Uncharacterized protein YlaI
gatagggagtgggaaaatgatacaaattaaaggagccgtaaagtttcctataacattaga
tagtacgacttggattttcgatgatagaaaagttagcatcgaagatttagaaaaaggtgt
atttgatggttcaaaaccaatcgactttgaagataatcatgaatggaatcgtgctatcct
agaaggacaaactaatccgcctactttaaattcagaaataaaatataaaaaacgtgccat
gttagaaggttcatttgtcattaatatgacaccatttttcaaacattccgaaccacatga
ctctgcaactactattcgattatcaaatgagcatgatcatttagatataccgatagatct
attaccctatttatttttccaatttgcaaaagacggtaaacgactttacagcgataatgg
tgtagatagttttatttacaatcaagaagatggttattcatatcgaatcaaccatgtaac
tcatattgaggtgatttaatttgagacaagtgcaatgcattatctgtgatgcaaaagtat
ttatagatgagcgcacaactgagtctaaacgacttaaaaacaatcctattcgaacattta
tgtgtgatgattgtaaaagtcgattagacacacctaaacaacgtgcgcaacactatccgc
tcgattaatatctgaataaacaagttagaaatttgaaaatgtgaaagtaacaggaaataa
tagcatttaaacactttttcaaatattatatgccaaaagagaagctaagcaactttcatc
gctcagcttctcttttattatgttaaattattcgttttcttgcatcatttgtttgatacg
ctttgcttctttttcacgaacatttttgtttaaaattttctttcttaaacgtatactttc
tggtgtaaccacaacaagttcatcatcattaatgaattgtaacgcttcttccaatgttag
aatacgcggtctattcattgtttgtgtttggtctttcgttgcagaacgtacgttagtttg
atgttttgttttagtgatgttaacagttaaatcattttcacgattatgttcaccaacaat
cataccttcataaacttcagtaccaggttccatgaagtttacacctctatcttcaagtcc
caaaatggcataagtacttgcagaacct


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT02SA1099 Staphylococcus aureus Mu50     B. subtilis YlaI protein homolog lmo1069
cmr|NT05SA0956 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
cmr|SACOL1119 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_1010 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB42207.1 Staphylococcus aureus subsp. aureus N315     conserved hypothetical protein
dbj|BAB57272.1 Staphylococcus aureus subsp. aureus Mu50     conserved hypothetical protein
dbj|BAB94858.1 Staphylococcus aureus subsp. aureus MW2     conserved hypothetical protein
dbj|BAF67247.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF77985.1 Staphylococcus aureus subsp. aureus Mu3     conserved hypothetical protein
emb|CAG40086.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   conserved hypothetical protein
emb|CAG42819.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   conserved hypothetical protein
fig|158878.1.peg.1110 Staphylococcus aureus subsp. aureus Mu50 FIG   Uncharacterized protein YlaI
fig|158878.14.peg.1138 Staphylococcus aureus subsp. aureus Mu50 FIG   Uncharacterized protein YlaI
fig|158879.1.peg.990 Staphylococcus aureus subsp. aureus N315 FIG   Uncharacterized protein YlaI
fig|158879.11.peg.1026 Staphylococcus aureus subsp. aureus N315 FIG   Uncharacterized protein YlaI
fig|196620.1.peg.993 Staphylococcus aureus subsp. aureus MW2 FIG   Uncharacterized protein YlaI
fig|196620.5.peg.1042 Staphylococcus aureus subsp. aureus MW2 FIG   Uncharacterized protein YlaI
fig|282458.1.peg.1015 Staphylococcus aureus subsp. aureus MRSA252 FIG   Uncharacterized protein YlaI
fig|282458.4.peg.1085 Staphylococcus aureus subsp. aureus MRSA252 FIG   Uncharacterized protein YlaI
fig|282459.1.peg.1036 Staphylococcus aureus subsp. aureus MSSA476 FIG   Uncharacterized protein YlaI
fig|282459.5.peg.1084 Staphylococcus aureus subsp. aureus MSSA476 FIG   Uncharacterized protein YlaI
fig|359786.13.peg.1243 Staphylococcus aureus subsp. aureus JH9 FIG   Uncharacterized protein YlaI
fig|359786.3.peg.2610 Staphylococcus aureus subsp. aureus JH9 FIG   Uncharacterized protein YlaI
fig|359787.11.peg.1225 Staphylococcus aureus subsp. aureus JH1 FIG   Uncharacterized protein YlaI
fig|359787.3.peg.763 Staphylococcus aureus subsp. aureus JH1 FIG   Uncharacterized protein YlaI
fig|367830.3.peg.2063 Staphylococcus aureus subsp. aureus USA300 FIG   Uncharacterized protein YlaI
fig|418127.6.peg.1120 Staphylococcus aureus subsp. aureus Mu3 FIG   Uncharacterized protein YlaI
fig|426430.8.peg.1056 Staphylococcus aureus subsp. aureus str. Newman FIG   Uncharacterized protein YlaI
fig|450394.6.peg.301 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Uncharacterized protein YlaI
fig|451515.3.peg.1108 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Uncharacterized protein YlaI
fig|451516.9.peg.1112 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Uncharacterized protein YlaI
fig|452948.4.peg.1352 Staphylococcus aureus 930918-3 FIG   Uncharacterized protein YlaI
fig|455227.3.peg.664 Staphylococcus aureus D30 FIG   Uncharacterized protein YlaI
fig|505321.3.peg.2293 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Uncharacterized protein YlaI
fig|546342.3.peg.1727 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Uncharacterized protein YlaI
fig|546343.3.peg.505 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Uncharacterized protein YlaI
fig|548470.3.peg.258 Staphylococcus aureus subsp. aureus MN8 FIG   Uncharacterized protein YlaI
fig|548473.3.peg.2241 Staphylococcus aureus subsp. aureus TCH60 FIG   Uncharacterized protein YlaI
fig|548474.3.peg.1205 Staphylococcus aureus subsp. aureus TCH130 FIG   Uncharacterized protein YlaI
fig|548475.3.peg.1341 Staphylococcus aureus subsp. aureus TCH70 FIG   Uncharacterized protein YlaI
fig|553565.3.peg.1693 Staphylococcus aureus A5937 FIG   Uncharacterized protein YlaI
fig|553567.3.peg.1436 Staphylococcus aureus A5948 FIG   Uncharacterized protein YlaI
fig|553568.3.peg.2179 Staphylococcus aureus A6224 FIG   Uncharacterized protein YlaI
fig|553571.3.peg.148 Staphylococcus aureus A6300 FIG   Uncharacterized protein YlaI
fig|553573.3.peg.1157 Staphylococcus aureus A8115 FIG   Uncharacterized protein YlaI
fig|553574.3.peg.1473 Staphylococcus aureus A8117 FIG   Uncharacterized protein YlaI
fig|553577.3.peg.2431 Staphylococcus aureus A8796 FIG   Uncharacterized protein YlaI
fig|553580.3.peg.1058 Staphylococcus aureus A8819 FIG   Uncharacterized protein YlaI
fig|553581.3.peg.1167 Staphylococcus aureus A9299 FIG   Uncharacterized protein YlaI
fig|553583.3.peg.1133 Staphylococcus aureus A9635 FIG   Uncharacterized protein YlaI
fig|553588.3.peg.2106 Staphylococcus aureus A9719 FIG   Uncharacterized protein YlaI
fig|553590.4.peg.156 Staphylococcus aureus A9754 FIG   Uncharacterized protein YlaI
fig|553592.3.peg.259 Staphylococcus aureus A9763 FIG   Uncharacterized protein YlaI
fig|553594.3.peg.2146 Staphylococcus aureus A9765 FIG   Uncharacterized protein YlaI
fig|553596.3.peg.2078 Staphylococcus aureus A9781 FIG   Uncharacterized protein YlaI
fig|553601.3.peg.2057 Staphylococcus aureus A10102 FIG   Uncharacterized protein YlaI
fig|585143.3.peg.1562 Staphylococcus aureus subsp. aureus 55/2053 FIG   Uncharacterized protein YlaI
fig|585144.3.peg.1930 Staphylococcus aureus subsp. aureus 58-424 FIG   Uncharacterized protein YlaI
fig|585145.3.peg.1555 Staphylococcus aureus subsp. aureus 65-1322 FIG   Uncharacterized protein YlaI
fig|585146.3.peg.1559 Staphylococcus aureus subsp. aureus 68-397 FIG   Uncharacterized protein YlaI
fig|585147.3.peg.593 Staphylococcus aureus subsp. aureus A017934/97 FIG   Uncharacterized protein YlaI
fig|585148.3.peg.594 Staphylococcus aureus subsp. aureus Btn1260 FIG   Uncharacterized protein YlaI
fig|585149.6.peg.1196 Staphylococcus aureus subsp. aureus C101 FIG   Uncharacterized protein YlaI
fig|585150.3.peg.1620 Staphylococcus aureus subsp. aureus C160 FIG   Uncharacterized protein YlaI
fig|585151.3.peg.649 Staphylococcus aureus subsp. aureus C427 FIG   Uncharacterized protein YlaI
fig|585152.3.peg.959 Staphylococcus aureus subsp. aureus D139 FIG   Uncharacterized protein YlaI
fig|585153.3.peg.1621 Staphylococcus aureus subsp. aureus E1410 FIG   Uncharacterized protein YlaI
fig|585154.3.peg.1030 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Uncharacterized protein YlaI
fig|585155.3.peg.2383 Staphylococcus aureus subsp. aureus H19 FIG   Uncharacterized protein YlaI
fig|585156.3.peg.578 Staphylococcus aureus subsp. aureus M1015 FIG   Uncharacterized protein YlaI
fig|585157.3.peg.701 Staphylococcus aureus subsp. aureus M809 FIG   Uncharacterized protein YlaI
fig|585158.3.peg.1548 Staphylococcus aureus subsp. aureus M876 FIG   Uncharacterized protein YlaI
fig|585159.3.peg.1162 Staphylococcus aureus subsp. aureus M899 FIG   Uncharacterized protein YlaI
fig|585160.3.peg.576 Staphylococcus aureus subsp. aureus WBG10049 FIG   Uncharacterized protein YlaI
fig|585161.3.peg.779 Staphylococcus aureus subsp. aureus WW2703/97 FIG   Uncharacterized protein YlaI
fig|585891.3.peg.1135 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Uncharacterized protein YlaI
fig|644279.4.peg.1117 Staphylococcus aureus subsp. aureus 132 FIG   Uncharacterized protein YlaI
fig|680649.3.peg.1411 Staphylococcus aureus subsp. aureus MR1 FIG   Uncharacterized protein YlaI
fig|681288.4.peg.1081 Staphylococcus aureus subsp. aureus ED98 FIG   Uncharacterized protein YlaI
fig|703339.3.peg.1080 Staphylococcus aureus 04-02981 FIG   Uncharacterized protein YlaI
fig|762962.3.peg.955 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Uncharacterized protein YlaI
fig|93061.3.peg.1015 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Uncharacterized protein YlaI
fig|93061.5.peg.972 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Uncharacterized protein YlaI
fig|93062.4.peg.1389 Staphylococcus aureus subsp. aureus COL FIG   Uncharacterized protein YlaI
gb|AAW37999.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD20476.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD30177.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ48970.1 Staphylococcus aureus subsp. aureus JH9     Uncharacterized protein-like protein
gb|ABR52046.1 Staphylococcus aureus subsp. aureus JH1     conserved hypothetical protein
gb|ABX29068.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_1048
gb|EEI94703.1 Staphylococcus aureus subsp. aureus MN8     conserved hypothetical protein
gb|EES55122.1 Staphylococcus aureus subsp. aureus TCH70     conserved hypothetical protein
gb|EES93264.1 Staphylococcus aureus subsp. aureus USA300_TCH959     conserved hypothetical protein
gb|EES97084.1 Staphylococcus aureus subsp. aureus TCH130     conserved hypothetical protein
gb|EEV04270.1 Staphylococcus aureus subsp. aureus 55/2053     conserved hypothetical protein
gb|EEV06153.1 Staphylococcus aureus subsp. aureus 65-1322     conserved hypothetical protein
gb|EEV09207.1 Staphylococcus aureus subsp. aureus 68-397     conserved hypothetical protein
gb|EEV11392.1 Staphylococcus aureus subsp. aureus E1410     conserved hypothetical protein
gb|EEV14463.1 Staphylococcus aureus subsp. aureus M876     conserved hypothetical protein
gb|EEV27471.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV65732.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV66537.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV70335.1 Staphylococcus aureus A9635     conserved hypothetical protein
gb|EEV72815.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV75399.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV79021.1 Staphylococcus aureus A6300     conserved hypothetical protein
gb|EEV79667.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV82990.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEV85588.1 Staphylococcus aureus A5937     conserved hypothetical protein
gb|EEW44938.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0920
gb|EEW47711.1 Staphylococcus aureus D30     hypothetical protein SAD30_1525
gi|13700911 Staphylococcus aureus subsp. aureus N315 NCBI   conserved hypothetical protein
gi|14246880 Staphylococcus aureus subsp. aureus Mu50 NCBI   conserved hypothetical protein
gi|147740672 Staphylococcus aureus subsp. aureus JH9 NCBI   Uncharacterized protein-like protein
gi|148267603 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_1170
gi|149946110 Staphylococcus aureus subsp. aureus JH1 NCBI   conserved hypothetical protein
gi|150373987 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150393658 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_1192
gi|151221187 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0975
gi|156721568 Staphylococcus aureus subsp. aureus Mu3 NCBI   conserved hypothetical protein
gi|156979433 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_1102
gi|15924100 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV1110
gi|15926695 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SAS032
gi|160368097 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1048
gi|161509288 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1048
gi|21204160 Staphylococcus aureus subsp. aureus MW2 NCBI   conserved hypothetical protein
gi|21282722 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW0993
gi|221138695 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_08645
gi|221140490 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_02506
gi|227244944 Staphylococcus aureus subsp. aureus MN8 NCBI   conserved hypothetical protein
gi|227558680 Staphylococcus aureus subsp. aureus MN8 NCBI   conserved hypothetical protein
gi|251802465 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|251814012 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|253316741 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_11470
gi|253724535 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   conserved hypothetical protein
gi|253728355 Staphylococcus aureus subsp. aureus TCH130 NCBI   conserved hypothetical protein
gi|253731721 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   conserved hypothetical protein
gi|253733655 Staphylococcus aureus subsp. aureus TCH130 NCBI   conserved hypothetical protein
gi|255005897 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_05490
gi|257272138 Staphylococcus aureus subsp. aureus 55/2053 NCBI   conserved hypothetical protein
gi|257274666 Staphylococcus aureus subsp. aureus 65-1322 NCBI   conserved hypothetical protein
gi|257278588 Staphylococcus aureus subsp. aureus 68-397 NCBI   conserved hypothetical protein
gi|257281255 Staphylococcus aureus subsp. aureus E1410 NCBI   conserved hypothetical protein
gi|257284343 Staphylococcus aureus subsp. aureus M876 NCBI   conserved hypothetical protein
gi|257425162 Staphylococcus aureus subsp. aureus 55/2053 NCBI   conserved hypothetical protein
gi|257427825 Staphylococcus aureus subsp. aureus 65-1322 NCBI   conserved hypothetical protein
gi|257430460 Staphylococcus aureus subsp. aureus 68-397 NCBI   conserved hypothetical protein
gi|257433162 Staphylococcus aureus subsp. aureus E1410 NCBI   conserved hypothetical protein
gi|257436061 Staphylococcus aureus subsp. aureus M876 NCBI   conserved hypothetical protein
gi|257789131 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257795159 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257841287 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257842109 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257846311 Staphylococcus aureus A9635 NCBI   conserved hypothetical protein
gi|257848830 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257851460 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257856103 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|257856764 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257860158 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|257862823 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258407132 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258421776 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258423610 Staphylococcus aureus A9635 NCBI   conserved hypothetical protein
gi|258436141 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258443370 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258444981 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|258449844 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258451943 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258454943 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|259159900 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0920
gi|259163151 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1525
gi|49241402 Staphylococcus aureus subsp. aureus MRSA252 NCBI   conserved hypothetical protein
gi|49244391 Staphylococcus aureus subsp. aureus MSSA476 NCBI   conserved hypothetical protein
gi|49483273 Staphylococcus aureus subsp. aureus MRSA252 NCBI   hypothetical protein SAR1084
gi|49485948 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS1045
gi|57285905 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57651719 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL1119
gi|87125962 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87159988 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_1010
gi|87202367 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194809 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01060
img|637092609 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099623 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637151882 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637154521 Staphylococcus aureus aureus MRSA252 IMG   hypothetical protein
img|637157272 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637298756 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637887662 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637893699 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639109897 Staphylococcus aureus aureus JH1 IMG   conserved hypothetical protein
img|640565521 Staphylococcus aureus aureus JH9 IMG   Uncharacterized protein-like protein
img|640779279 Staphylococcus aureus aureus JH1 IMG   hypothetical protein
img|640795355 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640903845 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641309018 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641770803 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_1010 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL1119 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0975 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sah:SaurJH1_1192 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_1170 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sam:MW0993 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_01060 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sar:SAR1084   KEGG   hypothetical protein
kegg|sas:SAS1045   KEGG   hypothetical protein
kegg|sau:SAS032   KEGG   hypothetical protein
kegg|sav:SAV1110   KEGG   hypothetical protein
kegg|saw:SAHV_1102 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_1048 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_371634.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV1110
ref|NP_374228.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SAS032
ref|NP_645810.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW0993
ref|YP_001246546.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_1170
ref|YP_001316333.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_1192
ref|YP_001332009.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0975
ref|YP_001441692.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_1102
ref|YP_001574947.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_1048
ref|YP_040497.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   hypothetical protein SAR1084
ref|YP_043169.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS1045
ref|YP_185983.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL1119
ref|YP_493708.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_1010
ref|YP_499606.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01060
ref|ZP_03563497.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_08645
ref|ZP_03564983.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_02506
ref|ZP_03988727.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   conserved hypothetical protein
ref|ZP_04828485.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   conserved hypothetical protein
ref|ZP_04839954.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_11470
ref|ZP_04865886.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   conserved hypothetical protein
ref|ZP_04867820.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   conserved hypothetical protein
ref|ZP_05144498.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_05490
ref|ZP_05601588.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   conserved hypothetical protein
ref|ZP_05604223.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   conserved hypothetical protein
ref|ZP_05606842.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   conserved hypothetical protein
ref|ZP_05609520.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   conserved hypothetical protein
ref|ZP_05612108.1 Staphylococcus aureus subsp. aureus M876 RefSeq   conserved hypothetical protein
ref|ZP_05644138.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05680281.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05684697.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05686500.1 Staphylococcus aureus A9635 RefSeq   conserved hypothetical protein
ref|ZP_05689124.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05691713.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05693298.1 Staphylococcus aureus A6300 RefSeq   conserved hypothetical protein
ref|ZP_05697942.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05699959.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
ref|ZP_05702906.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A5IRZ7 Staphylococcus aureus (strain JH9) TrEMBL   Uncharacterized protein-like protein
tr|A6QFW5 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A6U0S8 Staphylococcus aureus (strain JH1) TrEMBL   Putative uncharacterized protein
tr|A7X118 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8Z1P5 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|C2K9D7 Staphylococcus aureus subsp. aureus MN8 TrEMBL   Putative uncharacterized protein
tr|C5N4J4 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Putative uncharacterized protein
tr|C5Q101 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Putative uncharacterized protein
tr|C5QI69 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Putative uncharacterized protein
tr|Q2FHX0 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2G1Y9 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HGX4 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6GAA4 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative uncharacterized protein
tr|Q6GHX5 Staphylococcus aureus (strain MRSA252) TrEMBL   Putative uncharacterized protein
tr|Q7A163 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW0993
tr|Q7A670 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SAS032
tr|Q99UZ2 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search