The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93062.19.peg.107: Staphylococcus aureus subsp. aureus COL

This feature in The SEED Viewer

NCBI Taxonomy Id: 93062

Current Assignment: UDP-glucose 4-epimerase (EC 5.1.3.2)
Translate Function Assignments



Context on contig NC_002951 from base 122132 to 133998 (11867 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
100 122132 122908 777 +       1: 1   Siderophore staphylobactin biosynthesis protein SbnG locus|SACOL0106, protein_id|YP_185010.1, gi|57652469, geneID|3236845
101 122908 124110 1203 + -1     1: 1   Siderophore staphylobactin biosynthesis protein SbnH locus|SACOL0107, protein_id|YP_185011.1, gi|57652470, geneID|3236846
102 124114 124878 765 + 3     1: 1 dlit(14688077) L-serine kinase (ATP) (EC 2.7.1.225) locus|SACOL0108, protein_id|YP_185012.1, gi|57652471, geneID|3236847
103 125368 125481 114 + 489         hypothetical protein locus|SACOL0109, protein_id|YP_185013.1, gi|57652472, geneID|3236832
104 125531 126157 627 + 49         FIG01108113: hypothetical protein locus|SACOL0110, protein_id|YP_185014.1, gi|57652473, geneID|3236833
105 126369 127145 777 + 211     1: 3   2,3-butanediol dehydrogenase, S-alcohol forming, (R)-acetoin-specific (EC 1.1.1.4) @ Diacetyl reductase [(S)-acetoin forming] (EC 1.1.1.304) locus|SACOL0111, protein_id|YP_185015.1, gi|57652474, geneID|3236834
106 127346 127194 153 - 48         FIG01108063: hypothetical protein  
107 127490 128461 972 + 143         UDP-glucose 4-epimerase (EC 5.1.3.2) locus|SACOL0113, protein_id|YP_185017.1, gi|57652476, geneID|3236836
108 128424 129116 693 + -38         Putative undecaprenyl-phosphate N-acetylgalactosaminyl 1-phosphate transferase; teichuronic acid biosynthesis glycosyltransferase TuaA locus|SACOL0114, protein_id|YP_185018.1, gi|57652477, geneID|3236837
109 129326 130492 1167 + 209     1: 10   Exopolysaccharide biosynthesis glycosyltransferase EpsF (EC 2.4.1.-) locus|SACOL0115, protein_id|YP_185019.1, gi|57652478, geneID|3236838
110 130473 131711 1239 + -20         hypothetical protein locus|SACOL0116, protein_id|YP_185020.1, gi|57652479, geneID|3236824
111 131701 133131 1431 + -11     1: 2   Membrane protein involved in the export of O-antigen, teichoic acid lipoteichoic acids locus|SACOL0117, protein_id|YP_185021.1, gi|57652480, geneID|3236825
112 133399 133998 600 + 267     6: 4 6 8 7 9 5 dlit(7557308)
dlit(11948161)
dlit(14523108)
Superoxide dismutase [Mn] (EC 1.15.1.1); Superoxide dismutase [Fe] (EC 1.15.1.1) gene_name|sodA1, locus|SACOL0118, protein_id|YP_185022.1, gi|57652481, geneID|3236826

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93062.19.peg.107 UDP-glucose 4-epimerase (EC 5.1.3.2)
MERVLITGGAGFIGSHLVDDLQQDYDVYVLDNYRTGKRENIKSLADDHVFELDIREYDAV
EQIMKTYQFDYVIHLAALVSVAESVEKPILSQEINVVATLRLLEIIKKYNNHIKRFIFAS
SAAVYGDLPDLPKSDQSLILPLSPYAIDKYYGERTTLNYCSLYNIPTAVVKFFNVFGPRQ
DPKSQYSGVISKMFDSFEHNKPFTFFGDGLQTRDFVYVYDVVQSVRLIMEHKDAIGHGYN
IGTGTFTNLLEVYRIIGELYGKSVEHEFKEARKGDIKHSYADISNLKALGFVPKYTVETG
LKDYFNFEVDNIEEVTAKEVEMS

MD5 = 2c16a785afeb1ed6f08df57014085245


  DNA Sequence

>fig|93062.19.peg.107 UDP-glucose 4-epimerase (EC 5.1.3.2)
ttggaaagagttttgataactggtggggctggttttattgggtcgcatttagtagatgat
ttacaacaagattatgatgtttatgttctagataactatagaacaggtaaacgagaaaat
attaaaagtttggctgacgatcatgtgtttgaattagatattcgtgaatatgatgcagtt
gaacaaatcatgaagacatatcaatttgattatgttattcatttagcagcattagttagt
gttgctgagtcggttgagaaacctatcttatctcaagaaataaacgtcgtagcaacatta
agattgttagaaatcattaaaaaatataataatcatataaaacgttttatctttgcttcg
tcagcagctgtttatggtgatcttcctgatttgcctaaaagtgatcaatcattaatctta
ccattatcaccatatgcaatagataaatattacggcgaacggacgacattaaattattgt
tcgttatataacataccaacagcggttgttaaattttttaatgtatttgggccaagacag
gatcctaagtcacaatattcaggtgtgatttcaaagatgttcgattcatttgagcataac
aagccatttacattttttggtgacggactgcaaactagagattttgtatatgtatatgat
gttgttcaatctgtacgcttaattatggaacacaaagatgcaattggacacggttataac
attggtacaggcacttttactaatttattagaggtttatcgtattattggtgaattatat
ggaaaatcagtcgagcatgaatttaaagaagcacgaaaaggagatattaagcattcttat
gcagatatttctaacttaaaggcattaggatttgttcctaaatatacagtagaaacaggt
ttaaaggattactttaattttgaggtagataatattgaagaagttacagctaaagaagtg
gaaatgtcgtga


  DNA with Flanking Sequence

>fig|93062.19.peg.107 UDP-glucose 4-epimerase (EC 5.1.3.2)
gcatggggttgggaacaatttacaagtcagattgctttgggcagagtttctcaaccagaa
gatgtttcaaatgtagtgagcttcttagctggtaaagactctgattacattactggacaa
acaattattgtagatggtggtatgagattccgttaataatcatccactaatgataaataa
atccttattgttaagtttaatcacttagcagtaaggattttttagtgcacttagaaggga
gtgtattggtagaaaattaataagcgaagttcttaagtgagttatgatgtcacagtctaa
tgcatcagttgaaagcattattagtattaacacacccaagatattataaaacatcacaaa
aacaccactatctaatttatctcaataaaaattcacaaagttatctcattttatttttat
aaataaaaaatatcgataaaaagcttacaatactttatgtttttatgatatatttttaat
gtataaatgaggtggaagatttggaaagagttttgataactggtggggctggttttattg
ggtcgcatttagtagatgatttacaacaagattatgatgtttatgttctagataactata
gaacaggtaaacgagaaaatattaaaagtttggctgacgatcatgtgtttgaattagata
ttcgtgaatatgatgcagttgaacaaatcatgaagacatatcaatttgattatgttattc
atttagcagcattagttagtgttgctgagtcggttgagaaacctatcttatctcaagaaa
taaacgtcgtagcaacattaagattgttagaaatcattaaaaaatataataatcatataa
aacgttttatctttgcttcgtcagcagctgtttatggtgatcttcctgatttgcctaaaa
gtgatcaatcattaatcttaccattatcaccatatgcaatagataaatattacggcgaac
ggacgacattaaattattgttcgttatataacataccaacagcggttgttaaatttttta
atgtatttgggccaagacaggatcctaagtcacaatattcaggtgtgatttcaaagatgt
tcgattcatttgagcataacaagccatttacattttttggtgacggactgcaaactagag
attttgtatatgtatatgatgttgttcaatctgtacgcttaattatggaacacaaagatg
caattggacacggttataacattggtacaggcacttttactaatttattagaggtttatc
gtattattggtgaattatatggaaaatcagtcgagcatgaatttaaagaagcacgaaaag
gagatattaagcattcttatgcagatatttctaacttaaaggcattaggatttgttccta
aatatacagtagaaacaggtttaaaggattactttaattttgaggtagataatattgaag
aagttacagctaaagaagtggaaatgtcgtgaaaatgacattgaagctgtccataataat
aagggttatgcctatcaaagaaaattagacaaactagaagaagtgagaaaaagctattac
ccaattaaacgtgcgattgacttaattttaagcattgttttattatttttaactttaccg
attatggttatattcgccattgctatcgtcatagattcgccaggaaaccctatttatagt
caggttagagttgggaagatgggtaaattaattaaaatatacaaattacgttcgatgtgc
aaaaacgcagagaaaaacggtgcgcaatgggctgataaagatgatgatcgtataacaaat
gtcgggaagtttattcgtaaaacacgcattgatgaattaccacaactaattaatgttgtt
aaaggggaaatgagttttattggaccacgcccggaacgtccggaatttgtagaattattt
agttcagaagtgataggtttcgagcaaagatgtcttgttacaccagggttaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003824       F:catalytic activity
GO:0044237       P:cellular metabolic process
GO:0050662       F:coenzyme binding
cmr|NT05SA0077 Staphylococcus aureus NCTC 8325     NAD-dependent epimerase/dehydratase family protein
cmr|SACOL0113 Staphylococcus aureus subsp. aureus COL     NAD-dependent epimerase/dehydratase family protein
fig|426430.8.peg.77 Staphylococcus aureus subsp. aureus str. Newman FIG   UDP-glucose 4-epimerase (EC 5.1.3.2)
fig|450394.6.peg.1801 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   UDP-glucose 4-epimerase (EC 5.1.3.2)
fig|451515.3.peg.183 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   UDP-glucose 4-epimerase (EC 5.1.3.2)
fig|451516.9.peg.171 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   UDP-glucose 4-epimerase (EC 5.1.3.2)
fig|452948.4.peg.1169 Staphylococcus aureus 930918-3 FIG   UDP-glucose 4-epimerase (EC 5.1.3.2)
fig|455227.3.peg.1823 Staphylococcus aureus D30 FIG   UDP-glucose 4-epimerase (EC 5.1.3.2)
fig|548474.3.peg.89 Staphylococcus aureus subsp. aureus TCH130 FIG   UDP-glucose 4-epimerase (EC 5.1.3.2)
fig|553567.3.peg.1791 Staphylococcus aureus A5948 FIG   UDP-glucose 4-epimerase (EC 5.1.3.2)
fig|553590.4.peg.1126 Staphylococcus aureus A9754 FIG   UDP-glucose 4-epimerase (EC 5.1.3.2)
fig|644279.4.peg.196 Staphylococcus aureus subsp. aureus 132 FIG   UDP-glucose 4-epimerase (EC 5.1.3.2)
fig|93061.5.peg.78 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   UDP-glucose 4-epimerase (EC 5.1.3.2)
fig|93062.4.peg.584 Staphylococcus aureus subsp. aureus COL FIG   UDP-glucose 4-epimerase (EC 5.1.3.2)
gb|AAW38756.1 Staphylococcus aureus subsp. aureus COL     NAD-dependent epimerase/dehydratase family protein
gb|EEW45074.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0166
gb|EEW46732.1 Staphylococcus aureus D30     hypothetical protein SAD30_1864
gi|259160040 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0166
gi|259162155 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1864
gi|57286662 Staphylococcus aureus subsp. aureus COL NCBI   NAD-dependent epimerase/dehydratase family protein
gi|57652476 Staphylococcus aureus subsp. aureus COL NCBI   NAD-dependent epimerase/dehydratase family protein
img|637150900 Staphylococcus aureus aureus COL IMG   NAD-dependent epimerase/dehydratase family protein
img|641770744 Staphylococcus aureus aureus USA300_TCH959 IMG   UDP-glucose 4-epimerase
kegg|sac:SACOL0113 Staphylococcus aureus subsp. aureus COL KEGG   NAD-dependent epimerase/dehydratase family protein
ref|YP_185017.1 Staphylococcus aureus subsp. aureus COL RefSeq   NAD-dependent epimerase/dehydratase family protein
tr|Q5HJP0 Staphylococcus aureus (strain COL) TrEMBL   NAD-dependent epimerase/dehydratase family protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search