The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.971: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: GTP-binding protein TypA/BipA
Translate Function Assignments



Context on contig NC_007795 from base 1018278 to 1032262 (13985 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
965 1018278 1019297 1020 +           FIG01108899: hypothetical protein locus|SAOUHSC_01050, protein_id|YP_499599.1, gi|88194802, geneID|3921715
966 1019580 1019999 420 + 282         FIG01107917: hypothetical protein locus|SAOUHSC_01051, protein_id|YP_499600.1, gi|88194803, geneID|3921716
967 1021433 1020081 1353 - 81       dlit(23817615) Manganese transport protein MntH locus|SAOUHSC_01053, protein_id|YP_499601.1, gi|88194804, geneID|3921717
968 1022231 1021617 615 - 183         FIG01108286: hypothetical protein locus|SAOUHSC_01054, protein_id|YP_499602.1, gi|88194805, geneID|3921718
969 1022388 1023215 828 + 156 4 3: 2 5 9   Inositol-1-monophosphatase (EC 3.1.3.25) locus|SAOUHSC_01055, protein_id|YP_499603.1, gi|88194806, geneID|3921719
970 1023560 1023369 192 - 153         FIG01107843: hypothetical protein  
971 1023662 1025509 1848 + 101   1: 3   GTP-binding protein TypA/BipA locus|SAOUHSC_01058, protein_id|YP_499605.1, gi|88194808, geneID|3921721
972 1025816 1025649 168 - 139         Uncharacterized protein YlaI locus|SAOUHSC_01060, protein_id|YP_499606.1, gi|88194809, geneID|3921722
973 1026300 1025818 483 - 1         FIG01108239: hypothetical protein locus|SAOUHSC_01061, protein_id|YP_499607.1, gi|88194810, geneID|3921723
974 1026441 1026716 276 + 140       dlit(17469204) UPF0358 protein YlaN locus|SAOUHSC_01062, protein_id|YP_499608.1, gi|88194811, geneID|3921724
975 1027030 1028256 1227 + 313     4: 6 7 4 8   Cell division protein FtsW locus|SAOUHSC_01063, protein_id|YP_499609.1, gi|88194812, geneID|3921725
976 1028810 1032262 3453 + 553     2: 10 1   Pyruvate carboxylase (EC 6.4.1.1) locus|SAOUHSC_01064, protein_id|YP_499610.1, gi|88194813, geneID|3921726

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Universal_GTPases gjo GTP-binding protein TypA/BipA


  Protein Sequence

>fig|93061.5.peg.971 GTP-binding protein TypA/BipA
MTNKREDVRNIAIIAHVDHGKTTLVDELLKQSGIFRENEHVDERAMDSNDIERERGITIL
AKNTAVDYKGTRINILDTPGHADFGGEVERIMKMVDGVVLVVDAYEGTMPQTRFVLKKAL
EQNLKPVVVVNKIDKPSARPEGVVDEVLDLFIELEANDEQLEFPVVYASAVNGTASLDPE
KQDDNLQSLYETIIDYVPAPIDNSDEPLQFQVALLDYNDYVGRIGIGRVFRGKMRVGDNV
SLIKLDGTVKNFRVTKIFGYFGLKRLEIEEAQAGDLIAVSGMEDINVGETVTPHDHQEAL
PVLRIDEPTLEMTFKVNNSPFAGREGDFVTARQIQERLNQQLETDVSLKVSNTDSPDTWV
VAGRGELHLSILIENMRREGYELQVSKPQVIIKEIDGVMCEPFERVQCEVPQENAGAVIE
SLGARKGEMVDMTTTDNGLTRLIFNVPARGMIGYTTEFMSMTRGYGIINHTFEEFRPRIK
AQIGGRRNGALISMDQGSASTYAILGLEDRGVNFMEPGTEVYEGMIVGEHNRENDLTVNI
TKTKHQTNVRSATKDQTQTMNRPRILTLEEALQFINDDELVEVTPESIRLRKKILNKNVR
EKEAKRIKQMMQENE

MD5 = 706298fdbcf43936ecd499f3fb84a67d


  DNA Sequence

>fig|93061.5.peg.971 GTP-binding protein TypA/BipA
atgactaataaaagagaagatgtccgcaatatagcaattattgctcacgttgaccatggt
aaaacaactttagtagatgagttgttaaaacaatctggtatattcagagaaaatgaacat
gtcgatgaacgtgcaatggactctaacgatatcgaaagagagcgtggaattacgattcta
gccaaaaatacggctgttgattataaaggtacacgtattaatattttggatacaccagga
catgcagactttggtggagaagtagaacgtattatgaaaatggttgatggggttgtctta
gtagtagatgcgtatgaaggtacaatgcctcaaacacgttttgtacttaaaaaagcgcta
gaacaaaacctgaaacctgttgttgttgttaataaaattgataaaccatcagcacgtcca
gagggtgttgtagatgaagttttagatttatttattgaattagaagcaaacgatgaacaa
ttagaattccctgttgtttatgcttcagcagtaaatggtacagctagcttagatcctgaa
aagcaagatgataatttacaatcattatatgaaacaattattgattatgtaccagctcca
attgataacagtgatgagccattacaattccaagtagcattgttggactacaatgattat
gttggacgtattggtattggtcgtgtattcagaggtaaaatgcgtgtcggagataatgta
tcactaattaaattagacggtacagtgaaaaacttccgtgtaactaaaatctttggttac
tttggattaaaacgtttagaaattgaagaagcacaagctggagatttaattgctgtttca
ggtatggaagacattaatgttggtgaaactgtaacaccacatgaccatcaagaagcattg
ccagttctacgtattgatgagcctactcttgaaatgacatttaaagttaacaattctcca
tttgctggccgtgaaggtgactttgtaacagcacgtcaaattcaagaacgtttaaatcaa
caattagaaacagatgtatctttgaaagtttctaacacagattctccagatacatgggta
gttgctggtcgcggtgaattgcatttatcaatccttattgaaaatatgcgtcgtgaaggt
tatgaattacaagtttcaaaaccacaagtaattattaaagaaatagatggtgtaatgtgt
gaaccatttgaacgtgtgcaatgtgaagtgccacaagaaaatgcaggtgctgttattgaa
tcattaggtgcacgtaaaggtgaaatggttgatatgactacaactgataatggacttaca
cgtttaatctttaatgtaccggctcgtggtatgattggttatacgactgaatttatgtca
atgacaagaggttacggtattattaaccatacatttgaagaatttagaccacgtattaaa
gcacaaattggcggtcgtcgtaatggtgcattaatttcaatggatcaaggttctgcaagt
acttatgccattttgggacttgaagatagaggtgtaaacttcatggaacctggtactgaa
gtttatgaaggtatgattgttggtgaacataatcgtgaaaatgatttaactgttaacatc
actaaaacaaaacatcaaactaacgtacgttctgcaacgaaagaccaaacacaaacaatg
aatagaccgcgtattctaacattggaagaagcgttacaattcattaatgatgatgaactt
gttgaggttacaccagaaagtatacgtttaagaaagaaaattttaaacaaaaatgttcgt
gaaaaagaagcaaagcgtatcaaacaaatgatgcaagaaaacgaataa


  DNA with Flanking Sequence

>fig|93061.5.peg.971 GTP-binding protein TypA/BipA
catgatgcgttaatacaattacatgaacaacgatttaaaagaaaatcaaaataattacca
aaagcgtaatatgtagtcctaacaattaggtaacatattacgcttttataccttaaataa
taaaaacacgcgccaatataaaaccagttaaatgttcatcatgaacatgtgtggtcttaa
atcaacgcgtgttattgtcgatataacttatagccaatcgttttctcgatattttttctt
tgtagtaaatccaattccaaaggttgcaacgagtaatataaatgttaaaatcatcattgg
tacatttgatgcaccaacagcaaaactaaataatactaagaaaacaacagctaatataga
aaatacccaaaagatatttttagattttttttgtttcatcctatccccaccttttgctta
tcttttctcaattatatgatataataaaaaagttgtaattaaaagtgggattttacttaa
gaaagaaggaaactatttatatgactaataaaagagaagatgtccgcaatatagcaatta
ttgctcacgttgaccatggtaaaacaactttagtagatgagttgttaaaacaatctggta
tattcagagaaaatgaacatgtcgatgaacgtgcaatggactctaacgatatcgaaagag
agcgtggaattacgattctagccaaaaatacggctgttgattataaaggtacacgtatta
atattttggatacaccaggacatgcagactttggtggagaagtagaacgtattatgaaaa
tggttgatggggttgtcttagtagtagatgcgtatgaaggtacaatgcctcaaacacgtt
ttgtacttaaaaaagcgctagaacaaaacctgaaacctgttgttgttgttaataaaattg
ataaaccatcagcacgtccagagggtgttgtagatgaagttttagatttatttattgaat
tagaagcaaacgatgaacaattagaattccctgttgtttatgcttcagcagtaaatggta
cagctagcttagatcctgaaaagcaagatgataatttacaatcattatatgaaacaatta
ttgattatgtaccagctccaattgataacagtgatgagccattacaattccaagtagcat
tgttggactacaatgattatgttggacgtattggtattggtcgtgtattcagaggtaaaa
tgcgtgtcggagataatgtatcactaattaaattagacggtacagtgaaaaacttccgtg
taactaaaatctttggttactttggattaaaacgtttagaaattgaagaagcacaagctg
gagatttaattgctgtttcaggtatggaagacattaatgttggtgaaactgtaacaccac
atgaccatcaagaagcattgccagttctacgtattgatgagcctactcttgaaatgacat
ttaaagttaacaattctccatttgctggccgtgaaggtgactttgtaacagcacgtcaaa
ttcaagaacgtttaaatcaacaattagaaacagatgtatctttgaaagtttctaacacag
attctccagatacatgggtagttgctggtcgcggtgaattgcatttatcaatccttattg
aaaatatgcgtcgtgaaggttatgaattacaagtttcaaaaccacaagtaattattaaag
aaatagatggtgtaatgtgtgaaccatttgaacgtgtgcaatgtgaagtgccacaagaaa
atgcaggtgctgttattgaatcattaggtgcacgtaaaggtgaaatggttgatatgacta
caactgataatggacttacacgtttaatctttaatgtaccggctcgtggtatgattggtt
atacgactgaatttatgtcaatgacaagaggttacggtattattaaccatacatttgaag
aatttagaccacgtattaaagcacaaattggcggtcgtcgtaatggtgcattaatttcaa
tggatcaaggttctgcaagtacttatgccattttgggacttgaagatagaggtgtaaact
tcatggaacctggtactgaagtttatgaaggtatgattgttggtgaacataatcgtgaaa
atgatttaactgttaacatcactaaaacaaaacatcaaactaacgtacgttctgcaacga
aagaccaaacacaaacaatgaatagaccgcgtattctaacattggaagaagcgttacaat
tcattaatgatgatgaacttgttgaggttacaccagaaagtatacgtttaagaaagaaaa
ttttaaacaaaaatgttcgtgaaaaagaagcaaagcgtatcaaacaaatgatgcaagaaa
acgaataatttaacataataaaagagaagctgagcgatgaaagttgcttagcttctcttt
tggcatataatatttgaaaaagtgtttaaatgctattatttcctgttactttcacatttt
caaatttctaacttgtttattcagatattaatcgagcggatagtgttgcgcacgttgttt
aggtgtgtctaatcgacttttacaatcatcacacataaatgttcgaataggattgttttt
aagtcgtttagactcagttgtgcgctcatctataaatacttttgcatcacagataatgca
ttgcacttgtctcaaattaaatcacctcaatatgagttacatggttgattcgatatgaat
aaccatcttcttgattgtaaataaaactatctacaccattatcgctgtaaagtcgtttac
cgtcttttgcaaattggaaaaataaatagggtaatagatctatcggtatatctaaatgat
catgctcatttgataatcgaatagtagt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003746       F:translation elongation factor activity
GO:0003924       F:GTPase activity
GO:0005525       F:GTP binding
GO:0005622       C:intracellular
cmr|NT01SA1043 Staphylococcus aureus N315     GTP-binding protein TypA
cmr|NT02SA1098 Staphylococcus aureus Mu50     GTP-binding protein TypA
cmr|NT03SA1082 Staphylococcus aureus MW2     GTP-binding protein TypA
cmr|NT05SA0955 Staphylococcus aureus NCTC 8325     GTP-binding protein TypA
cmr|NT09SA1040 Staphylococcus aureus subsp. aureus MSSA476     GTP-binding protein TypA
cmr|SAUSA300_1009 Staphylococcus aureus subsp. aureus USA300-FPR3757     GTP-binding protein
dbj|BAB42206.1 Staphylococcus aureus subsp. aureus N315     SA0959
dbj|BAB57271.1 Staphylococcus aureus subsp. aureus Mu50     GTP-binding elongation factor homologue
dbj|BAB94857.1 Staphylococcus aureus subsp. aureus MW2     MW0992
dbj|BAF67246.1 Staphylococcus aureus subsp. aureus str. Newman     small GTP-binding protein domain:GTP-binding protein TypA
dbj|BAF77984.1 Staphylococcus aureus subsp. aureus Mu3     GTP-binding elongation factor homologue
emb|CAG42818.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   BipA family GTPase
fig|158878.1.peg.1109 Staphylococcus aureus subsp. aureus Mu50 FIG   GTP-binding protein TypA/BipA
fig|158878.14.peg.1137 Staphylococcus aureus subsp. aureus Mu50 FIG   GTP-binding protein TypA/BipA
fig|158879.1.peg.989 Staphylococcus aureus subsp. aureus N315 FIG   GTP-binding protein TypA/BipA
fig|158879.11.peg.1025 Staphylococcus aureus subsp. aureus N315 FIG   GTP-binding protein TypA/BipA
fig|196620.1.peg.992 Staphylococcus aureus subsp. aureus MW2 FIG   GTP-binding protein TypA/BipA
fig|196620.5.peg.1041 Staphylococcus aureus subsp. aureus MW2 FIG   GTP-binding protein TypA/BipA
fig|282459.1.peg.1035 Staphylococcus aureus subsp. aureus MSSA476 FIG   GTP-binding protein TypA/BipA
fig|282459.5.peg.1083 Staphylococcus aureus subsp. aureus MSSA476 FIG   GTP-binding protein TypA/BipA
fig|367830.3.peg.2062 Staphylococcus aureus subsp. aureus USA300 FIG   GTP-binding protein TypA/BipA
fig|418127.4.peg.1015 Staphylococcus aureus subsp. aureus Mu3 FIG   GTP-binding protein TypA/BipA
fig|418127.6.peg.1119 Staphylococcus aureus subsp. aureus Mu3 FIG   GTP-binding protein TypA/BipA
fig|426430.6.peg.944 Staphylococcus aureus subsp. aureus str. Newman FIG   GTP-binding protein TypA/BipA
fig|426430.8.peg.1055 Staphylococcus aureus subsp. aureus str. Newman FIG   GTP-binding protein TypA/BipA
fig|450394.6.peg.300 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   GTP-binding protein TypA/BipA
fig|451515.3.peg.1107 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   GTP-binding protein TypA/BipA
fig|451516.9.peg.1111 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   GTP-binding protein TypA/BipA
fig|452948.4.peg.1353 Staphylococcus aureus 930918-3 FIG   GTP-binding protein TypA/BipA
fig|455227.3.peg.663 Staphylococcus aureus D30 FIG   GTP-binding protein TypA/BipA
fig|505321.3.peg.2292 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   GTP-binding protein TypA/BipA
fig|546342.3.peg.1728 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   GTP-binding protein TypA/BipA
fig|546343.3.peg.506 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   GTP-binding protein TypA/BipA
fig|548474.3.peg.1206 Staphylococcus aureus subsp. aureus TCH130 FIG   GTP-binding protein TypA/BipA
fig|548475.3.peg.1340 Staphylococcus aureus subsp. aureus TCH70 FIG   GTP-binding protein TypA/BipA
fig|553565.3.peg.1694 Staphylococcus aureus A5937 FIG   GTP-binding protein TypA/BipA
fig|553567.3.peg.1437 Staphylococcus aureus A5948 FIG   GTP-binding protein TypA/BipA
fig|553573.3.peg.1156 Staphylococcus aureus A8115 FIG   GTP-binding protein TypA/BipA
fig|553574.3.peg.1472 Staphylococcus aureus A8117 FIG   GTP-binding protein TypA/BipA
fig|553581.3.peg.1168 Staphylococcus aureus A9299 FIG   GTP-binding protein TypA/BipA
fig|553583.3.peg.1132 Staphylococcus aureus A9635 FIG   GTP-binding protein TypA/BipA
fig|553590.4.peg.155 Staphylococcus aureus A9754 FIG   GTP-binding protein TypA/BipA
fig|553592.3.peg.258 Staphylococcus aureus A9763 FIG   GTP-binding protein TypA/BipA
fig|553594.3.peg.2145 Staphylococcus aureus A9765 FIG   GTP-binding protein TypA/BipA
fig|585152.3.peg.958 Staphylococcus aureus subsp. aureus D139 FIG   GTP-binding protein TypA/BipA
fig|585891.3.peg.1134 Staphylococcus aureus subsp. aureus Mu50-omega FIG   GTP-binding protein TypA/BipA
fig|644279.4.peg.1116 Staphylococcus aureus subsp. aureus 132 FIG   GTP-binding protein TypA/BipA
fig|680649.3.peg.1410 Staphylococcus aureus subsp. aureus MR1 FIG   GTP-binding protein TypA/BipA
fig|681288.4.peg.1080 Staphylococcus aureus subsp. aureus ED98 FIG   GTP-binding protein TypA/BipA
fig|762962.3.peg.956 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   GTP-binding protein TypA/BipA
fig|93061.3.peg.1014 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   GTP-binding protein TypA/BipA
gb|ABD20464.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     GTP-binding protein
gb|ABD30176.1 Staphylococcus aureus subsp. aureus NCTC 8325     GTP-binding protein TypA, putative
gb|ABX29067.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     GTP-binding protein TypA
gb|EES55121.1 Staphylococcus aureus subsp. aureus TCH70     GTP-binding protein TypA
gb|EES93263.1 Staphylococcus aureus subsp. aureus USA300_TCH959     GTP-binding protein TypA
gb|EES97085.1 Staphylococcus aureus subsp. aureus TCH130     GTP-binding protein TypA
gb|EEV65731.1 Staphylococcus aureus A9763     small GTP-binding protein
gb|EEV70334.1 Staphylococcus aureus A9635     GTP-binding protein TypA/BipA
gb|EEV72816.1 Staphylococcus aureus A9299     GTP-binding protein TypA
gb|EEV75398.1 Staphylococcus aureus A8115     GTP-binding protein
gb|EEV82991.1 Staphylococcus aureus A5948     GTP-binding protein TypA/BipA
gb|EEV85589.1 Staphylococcus aureus A5937     GTP-binding protein TypA/BipA
gb|EEW44920.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0902
gb|EEW47710.1 Staphylococcus aureus D30     hypothetical protein SAD30_1524
gi|13700910 Staphylococcus aureus subsp. aureus N315 NCBI   SA0959
gi|14246879 Staphylococcus aureus subsp. aureus Mu50 NCBI   GTP-binding elongation factor homologue
gi|150373986 Staphylococcus aureus subsp. aureus str. Newman NCBI   small GTP-binding protein domain:GTP-binding protein TypA
gi|151221186 Staphylococcus aureus subsp. aureus str. Newman NCBI   GTP-binding protein TypA
gi|156721567 Staphylococcus aureus subsp. aureus Mu3 NCBI   GTP-binding elongation factor homologue
gi|156979432 Staphylococcus aureus subsp. aureus Mu3 NCBI   GTP-binding elongation factor homologue
gi|15924099 Staphylococcus aureus subsp. aureus Mu50 NCBI   GTP-binding elongation factor-like protein
gi|15926694 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0959
gi|160368096 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   GTP-binding protein TypA
gi|161509287 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   GTP-binding protein TypA
gi|21204159 Staphylococcus aureus subsp. aureus MW2 NCBI   MW0992
gi|21282721 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW0992
gi|221138696 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   GTP-binding protein TypA
gi|221140491 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   GTP-binding protein TypA
gi|251802464 Staphylococcus aureus subsp. aureus TCH70 NCBI   GTP-binding protein TypA
gi|251814011 Staphylococcus aureus subsp. aureus TCH70 NCBI   GTP-binding protein TypA
gi|253316740 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   GTP-binding protein
gi|253724534 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   GTP-binding protein TypA
gi|253728356 Staphylococcus aureus subsp. aureus TCH130 NCBI   GTP-binding protein TypA
gi|253731720 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   GTP-binding protein TypA
gi|253733656 Staphylococcus aureus subsp. aureus TCH130 NCBI   GTP-binding protein TypA
gi|255005896 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   GTP-binding protein
gi|257841286 Staphylococcus aureus A9763 NCBI   small GTP-binding protein
gi|257846310 Staphylococcus aureus A9635 NCBI   GTP-binding protein TypA/BipA
gi|257848831 Staphylococcus aureus A9299 NCBI   GTP-binding protein TypA
gi|257851459 Staphylococcus aureus A8115 NCBI   GTP-binding protein
gi|257860159 Staphylococcus aureus A5948 NCBI   GTP-binding protein TypA/BipA
gi|257862824 Staphylococcus aureus A5937 NCBI   GTP-binding protein TypA/BipA
gi|258407131 Staphylococcus aureus A9763 NCBI   small GTP-binding protein
gi|258423609 Staphylococcus aureus A9635 NCBI   GTP-binding protein TypA/BipA
gi|258436142 Staphylococcus aureus A9299 NCBI   GTP-binding protein TypA
gi|258443369 Staphylococcus aureus A8115 NCBI   GTP-binding protein
gi|258451944 Staphylococcus aureus A5948 NCBI   GTP-binding protein TypA/BipA
gi|258454944 Staphylococcus aureus A5937 NCBI   GTP-binding protein TypA/BipA
gi|259159882 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0902
gi|259163150 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1524
gi|49244390 Staphylococcus aureus subsp. aureus MSSA476 NCBI   BipA family GTPase
gi|49485947 Staphylococcus aureus subsp. aureus MSSA476 NCBI   BipA family GTPase
gi|87125950 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   GTP-binding protein
gi|87159976 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   GTP-binding protein
gi|87202366 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   GTP-binding protein TypA, putative
gi|88194808 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   GTP-binding protein TypA, putative
img|637092608 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099622 Staphylococcus aureus aureus Mu50 IMG   GTP-binding elongation factor homolog
img|637157271 Staphylococcus aureus aureus MSSA476 IMG   BipA family GTPase
img|637298755 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637887661 Staphylococcus aureus aureus USA300 IMG   GTP-binding protein
img|637893698 Staphylococcus aureus aureus NCTC 8325 IMG   GTP-binding protein TypA, putative
img|640795354 Staphylococcus aureus aureus Newman IMG   small GTP-binding protein domain:GTP-binding protein TypA
img|640903844 Staphylococcus aureus aureus Mu3 IMG   GTP-binding elongation factor homologue
img|641309017 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   GTP-binding protein TypA
img|641770804 Staphylococcus aureus aureus USA300_TCH959 IMG   GTP-binding protein TypA
kegg|saa:SAUSA300_1009 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   GTP-binding protein
kegg|sae:NWMN_0974 Staphylococcus aureus subsp. aureus Newman KEGG   GTP-binding protein TypA
kegg|sam:MW0992 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_01058 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   GTP-binding protein TypA, putative
kegg|sas:SAS1044   KEGG   BipA family GTPase
kegg|sau:SA0959   KEGG   hypothetical protein
kegg|sav:SAV1109   KEGG   GTP-binding elongation factor-like protein
kegg|saw:SAHV_1101 Staphylococcus aureus subsp. aureus Mu3 KEGG   GTP-binding elongation factor homologue
kegg|sax:USA300HOU_1047 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   GTP-binding protein TypA
ref|NP_371633.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   GTP-binding elongation factor-like protein
ref|NP_374227.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0959
ref|NP_645809.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW0992
ref|YP_001332008.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   GTP-binding protein TypA
ref|YP_001441691.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   GTP-binding elongation factor homologue
ref|YP_001574946.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   GTP-binding protein TypA
ref|YP_043168.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   BipA family GTPase
ref|YP_493707.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   GTP-binding protein
ref|YP_499605.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   GTP-binding protein TypA, putative
ref|ZP_03563498.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   GTP-binding protein TypA
ref|ZP_03564984.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   GTP-binding protein TypA
ref|ZP_04828484.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   GTP-binding protein TypA
ref|ZP_04839953.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   GTP-binding protein
ref|ZP_04865885.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   GTP-binding protein TypA
ref|ZP_04867821.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   GTP-binding protein TypA
ref|ZP_05144497.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   GTP-binding protein
ref|ZP_05680280.1 Staphylococcus aureus A9763 RefSeq   small GTP-binding protein
ref|ZP_05686499.1 Staphylococcus aureus A9635 RefSeq   GTP-binding protein TypA/BipA
ref|ZP_05689125.1 Staphylococcus aureus A9299 RefSeq   GTP-binding protein TypA
ref|ZP_05691712.1 Staphylococcus aureus A8115 RefSeq   GTP-binding protein
ref|ZP_05699960.1 Staphylococcus aureus A5948 RefSeq   GTP-binding protein TypA/BipA
ref|ZP_05702907.1 Staphylococcus aureus A5937 RefSeq   GTP-binding protein TypA/BipA
tr|A6QFW4 Staphylococcus aureus (strain Newman) TrEMBL   Small GTP-binding protein domain:GTP-binding protein TypA
tr|A7X117 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   GTP-binding elongation factor homologue
tr|A8Z1P4 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   GTP-binding protein TypA
tr|C5N4J3 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   GTP-binding protein TypA
tr|C5Q102 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   GTP-binding protein TypA
tr|C5QI68 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   GTP-binding protein TypA
tr|Q2FHX1 Staphylococcus aureus (strain USA300) TrEMBL   GTP-binding protein
tr|Q2G1Y6 Staphylococcus aureus (strain NCTC 8325) TrEMBL   GTP-binding protein TypA, putative
tr|Q6GAA5 Staphylococcus aureus (strain MSSA476) TrEMBL   BipA family GTPase
tr|Q7A164 Staphylococcus aureus (strain MW2) TrEMBL   MW0992 protein
tr|Q7A671 Staphylococcus aureus (strain N315) TrEMBL   SA0959 protein
tr|Q99UZ3 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   GTP-binding elongation factor homologue


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|93061.5.peg.969 Inositol-1-monophosphatase (EC 3.1.3.25)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search