The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.828: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Uncharacterized protein UPF0344
Translate Function Assignments



Context on contig NC_007795 from base 871848 to 882433 (10586 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
826 871848 875501 3654 +       1: 4   ATP-dependent nuclease, subunit A locus|SAOUHSC_00905, protein_id|YP_499458.1, gi|88194662, geneID|3921751
827 875667 876569 903 + 165     4: 3 6 5 8   Fumarylacetoacetate hydrolase family protein locus|SAOUHSC_00906, protein_id|YP_499459.1, gi|88194663, geneID|3921752
828 876898 877287 390 + 328     2: 1 7   Uncharacterized protein UPF0344 locus|SAOUHSC_00907, protein_id|YP_499460.1, gi|88194664, geneID|3921753
829 878774 877458 1317 - 170         CoA-disulfide reductase (EC 1.8.1.14) locus|SAOUHSC_00908, protein_id|YP_499461.1, gi|88194665, geneID|3920795
830 879650 878826 825 - 51     1: 2   5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase (EC 3.1.3.104) locus|SAOUHSC_00909, protein_id|YP_499462.1, gi|88194666, geneID|3920796
831 879764 880072 309 + 113         PaaD-like protein (DUF59) involved in Fe-S cluster assembly locus|SAOUHSC_00910, protein_id|YP_499463.1, gi|88194667, geneID|3920797
832 880619 882433 1815 + 546         Acyltransferase locus|SAOUHSC_00911, protein_id|YP_499464.1, gi|88194668, geneID|3920798

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CPO_analysis SvetaG Uncharacterized protein UPF0344
Experimental_tye SvetaG Uncharacterized protein UPF0344


  Protein Sequence

>fig|93061.5.peg.828 Uncharacterized protein UPF0344
MLHLHILSWVLAIILFIATYLNISKNQGRSPFFKPLHMILRLFMLLTLISGFWILIQSFM
NGGANHMLLTLKMLCGVAVVGLMEVSIAKRKRHEQSHTMFWITIALIIITMVLGVILPLG
PISKLFGIG

MD5 = dbf1af2334c90ad38ae12380a319c1d0


  DNA Sequence

>fig|93061.5.peg.828 Uncharacterized protein UPF0344
atgttacatttacatatattaagttgggtattagcgattattttatttatcgctacatac
ttaaacatttcaaaaaatcaaggcagatcaccatttttcaaaccgttgcacatgatttta
cgcttatttatgctgttgacgttaatttcaggattttggatattaattcagtcatttatg
aatggcggggcaaatcatatgttgcttacattgaaaatgctgtgtggtgttgcagtagtt
ggattgatggaagtgtcgattgctaaaagaaagagacatgaacaaagtcacacaatgttt
tggataacaattgcattaattatcatcacaatggtattaggtgtcattctaccgttaggg
cctatatcaaaattattcggtattggctaa


  DNA with Flanking Sequence

>fig|93061.5.peg.828 Uncharacterized protein UPF0344
aatagaagaaatttcaaaatatgttgcactacatccgggagatattattgcaactggtac
accagcaggcgttggtgcaggtatgcaaccacctaaatttttacaaccaggtgatgaagt
taaagtgactattgataatattggaacgctgacaacttatatcgctaaataattatcatt
taaaaagctaaccagtctttatatagattggttagttttttcttgcttttctaaaaaggt
gttaaagataaattatttataatgttaccattttgagatgaaagtgaaatattgatatta
agaagtagttgattattttacagcagattcacaatattctaataaggaataaaatgtcat
gttcttcctctcaaatatagaagtgtggtagaatatatattcgtgtataatcaaatcatg
attaaattacaagcaagtgggtattaatcccaagaagctttaatttaataatataaataa
ttaaagtggggggaatcagtatgttacatttacatatattaagttgggtattagcgatta
ttttatttatcgctacatacttaaacatttcaaaaaatcaaggcagatcaccatttttca
aaccgttgcacatgattttacgcttatttatgctgttgacgttaatttcaggattttgga
tattaattcagtcatttatgaatggcggggcaaatcatatgttgcttacattgaaaatgc
tgtgtggtgttgcagtagttggattgatggaagtgtcgattgctaaaagaaagagacatg
aacaaagtcacacaatgttttggataacaattgcattaattatcatcacaatggtattag
gtgtcattctaccgttagggcctatatcaaaattattcggtattggctaattgataagac
atatagtatatgacataaggcatggacaattattagtccaagaccttatgtcttttttga
ttctaaaaatgttaaacataaaaaatggactggatagtagtaccagtccaacataattct
aacctagacaattaagattagattgaatcgcatgattcatttatttagctttgtaaccaa
tcatattgattaaatctttagggtggctatatggtggtgcataagccacttcaaactcag
ttaactcatctacagttagctggttcatcattgccatcgatagtacatcaatacgtttat
ctgcaccttcttttcctactgcagctgctcttaaaatctgacggtttgaagtgtcataat
atactcttaagtgtaaaggggaatttcctgggtaataattcgcgtgtgcaccttgagtga
cttctaccattttatagtcaaattgctttagttcgtttggtttaacgccgacactcgcaa
atgtataatc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005886       C:plasma membrane
GO:0016021       C:integral to membrane
cmr|NT05SA0815 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
cmr|SACOL0974 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_0872 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAF67112.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.950 Staphylococcus aureus subsp. aureus USA300 FIG   Uncharacterized protein UPF0344
fig|426430.8.peg.913 Staphylococcus aureus subsp. aureus str. Newman FIG   Uncharacterized protein UPF0344
fig|451515.3.peg.964 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Uncharacterized protein UPF0344
fig|451516.9.peg.969 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Uncharacterized protein UPF0344
fig|452948.4.peg.1281 Staphylococcus aureus 930918-3 FIG   Uncharacterized protein UPF0344
fig|455227.3.peg.1327 Staphylococcus aureus D30 FIG   Uncharacterized protein UPF0344
fig|546342.3.peg.576 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Uncharacterized protein UPF0344
fig|546343.3.peg.2168 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Uncharacterized protein UPF0344
fig|553567.3.peg.1581 Staphylococcus aureus A5948 FIG   Uncharacterized protein UPF0344
fig|553590.4.peg.12 Staphylococcus aureus A9754 FIG   Uncharacterized protein UPF0344
fig|553594.3.peg.1261 Staphylococcus aureus A9765 FIG   Uncharacterized protein UPF0344
fig|644279.4.peg.973 Staphylococcus aureus subsp. aureus 132 FIG   Uncharacterized protein UPF0344
fig|93061.3.peg.873 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Uncharacterized protein UPF0344
fig|93062.4.peg.1125 Staphylococcus aureus subsp. aureus COL FIG   Uncharacterized protein UPF0344
gb|AAW37941.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD22107.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD30032.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX28949.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical membrane protein
gb|EEV83126.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW44998.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1466
gb|EEW47120.1 Staphylococcus aureus D30     hypothetical protein SAD30_1618
gi|122539892 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0344 protein SAOUHSC_00907
gi|123486581 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0344 protein SAUSA300_0872
gi|150373852 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151221052 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0840
gi|160367978 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical membrane protein
gi|161509169 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0928
gi|172048810 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0344 protein NWMN_0840
gi|189040638 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0344 protein USA300HOU_0928
gi|221137594 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_02938
gi|221142115 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_10840
gi|257860294 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258452079 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259159962 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1466
gi|259162552 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1618
gi|57285847 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57651661 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0974
gi|83287804 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0344 protein SACOL0974
gi|87127593 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87161619 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0872
gi|87202222 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194664 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00907
img|637151739 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637887524 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637893551 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640795218 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641308897 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical membrane protein
img|641772266 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical membrane protein
kegg|saa:SAUSA300_0872 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL0974 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0840 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_00907 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_0928 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001331874.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0840
ref|YP_001574828.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_0928
ref|YP_185842.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0974
ref|YP_493572.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0872
ref|YP_499460.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00907
ref|ZP_03562400.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_02938
ref|ZP_03566608.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_10840
ref|ZP_05700095.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
sp|A6QFI0 Staphylococcus aureus (strain Newman) SwissProt   RecName: Full=UPF0344 protein NWMN_0840
sp|A8Z075 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   RecName: Full=UPF0344 protein USA300HOU_0928
sp|Q2FIA6 Staphylococcus aureus (strain USA300) SwissProt   RecName: Full=UPF0344 protein SAUSA300_0872
sp|Q2FZT3 Staphylococcus aureus (strain NCTC 8325) SwissProt   RecName: Full=UPF0344 protein SAOUHSC_00907
sp|Q5HHB5 Staphylococcus aureus (strain COL) SwissProt   RecName: Full=UPF0344 protein SACOL0974
sp|Y840_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0344 protein NWMN_0840
sp|Y872_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0344 protein SAUSA300_0872
sp|Y907_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0344 protein SAOUHSC_00907
sp|Y928_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0344 protein USA300HOU_0928
sp|Y974_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0344 protein SACOL0974


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search