The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.744: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: FIG01107975: hypothetical protein
Translate Function Assignments



Context on contig NC_007795 from base 797866 to 808888 (11023 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
737 797866 798888 1023 +       1: 2   Extracellular ECM and plasma binding protein Emp locus|SAOUHSC_00816, protein_id|YP_499371.1, gi|88194575, geneID|3919378
738 799223 799693 471 + 334     1: 2   Hypothetical protein, similarity with von Willebrand factor-binding VWbp locus|SAOUHSC_00817, protein_id|YP_499372.1, gi|88194576, geneID|3919379
739 800034 800720 687 + 340     1: 12   Phage-encoded chromosome degrading nuclease YokF locus|SAOUHSC_00818, protein_id|YP_499373.1, gi|88194577, geneID|3919380
740 801077 801277 201 + 356     1: 7 dlit(10515936) Cold shock protein of CSP family locus|SAOUHSC_00819, protein_id|YP_499374.1, gi|88194578, geneID|3919381
741 801991 801773 219 - 495         FIG01108124: hypothetical protein locus|SAOUHSC_00820, protein_id|YP_499375.1, gi|88194579, geneID|3919382
742 802337 802053 285 - 61         FIG01108459: hypothetical protein locus|SAOUHSC_00821, protein_id|YP_499376.1, gi|88194580, geneID|3919383
743 802994 802425 570 - 87         FIG01107922: hypothetical protein locus|SAOUHSC_00822, protein_id|YP_499377.1, gi|88194581, geneID|3919384
744 803370 803182 189 - 187         FIG01107975: hypothetical protein locus|SAOUHSC_00823, protein_id|YP_499378.1, gi|88194582, geneID|3919385
745 803668 803399 270 - 28         FIG01108213: hypothetical protein locus|SAOUHSC_00824, protein_id|YP_499379.1, gi|88194583, geneID|3919386
746 804000 804203 204 + 331         Uncharacterized protein SAV0822 locus|SAOUHSC_00825, protein_id|YP_499380.1, gi|88194584, geneID|3919387
747 804436 804200 237 - -4         FIG01108334: hypothetical protein locus|SAOUHSC_00826, protein_id|YP_499381.1, gi|88194585, geneID|3919388
748 804661 805242 582 + 224     1: 1   Phosphoglycerate mutase family protein locus|SAOUHSC_00827, protein_id|YP_499382.1, gi|88194586, geneID|3919389
749 805932 805315 618 - 72         Transporter, LysE family locus|SAOUHSC_00828, protein_id|YP_499383.1, gi|88194587, geneID|3918941
750 806581 806087 495 - 154         FIG01108288: hypothetical protein locus|SAOUHSC_00830, protein_id|YP_499384.1, gi|88194588, geneID|3918942
751 807402 806980 423 - 398     2: 8 4   Organic hydroperoxide resistance protein locus|SAOUHSC_00831, protein_id|YP_499385.1, gi|88194589, geneID|3918943
752 807550 808266 717 + 147     6: 9 11 13 3 6 5   3-dehydroquinate dehydratase I (EC 4.2.1.10) locus|SAOUHSC_00832, protein_id|YP_499386.1, gi|88194590, geneID|3918944
753 808349 808888 540 + 82     2: 1 10   Nitroreductase family protein locus|SAOUHSC_00833, protein_id|YP_499387.1, gi|88194591, geneID|3918945

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.744 FIG01107975: hypothetical protein
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFG
VL

MD5 = 1eb9c4762aab37c76982cba31b71f41d


  DNA Sequence

>fig|93061.5.peg.744 FIG01107975: hypothetical protein
atgtctttacattttgcaattctgttttggctagcattaattttcttagttgccgctacg
tttatactcgtattaatgaaaaaaactagcaaagaatctaaaaaagagtcctatttaagt
ttcactgtcattctctatatttttggattcgctatattaatatacacatttatatttggt
gtgctataa


  DNA with Flanking Sequence

>fig|93061.5.peg.744 FIG01107975: hypothetical protein
acgaattatacaactttaagagtttttagtatgtaaatattcttttcatattaatacaat
acacccctatatatgctcacttgtttgaattaataaactttagcattctgcaaataatat
tttaaaaataactatactttttatttacctattgaaaaatagtgttatcatatttattaa
gaagctatttttatactagtaggtgtcagtcatgaataacattttgttaaatgctatcaa
tatagttattactaccacttttgttatctttaatattttaatcacatataataaagattt
agatgatttatgttggctcctgcctggtattatcatttgtggtgtgatactcatcgtatc
ctttaccattgcaatgataactaaaaactggttaagtgaaatattattttttataaatat
cgtactcgttctctattacatttatcctattttttatagttttataggttaataattacg
gtatataaggagggtttcacatgtctttacattttgcaattctgttttggctagcattaa
ttttcttagttgccgctacgtttatactcgtattaatgaaaaaaactagcaaagaatcta
aaaaagagtcctatttaagtttcactgtcattctctatatttttggattcgctatattaa
tatacacatttatatttggtgtgctataaatgaaattcattttatatccagtctgaaacg
tctcaatgatgtttcagactgttttttattcttaatagacatttcacactctcatacttt
aatatttaagatatgttttagtcttacaagcttattaaagattacaattctaatttaaga
ctatttacatatatttcttcaacaaggagcttttaagtgaactatattaaacgaacgata
attttacttatattattcgttgtcgtatccccaataaactcaccaaaaacaattgcagat
aataagtattcagaaattcaagatgacaaattccaattacaacctggtgatattattgtt
acaaaaggccctgtcatgtggggattttttggtcattgtagtatcgcgattgatgataaa
acgattttacaaattgaggggcctggcgacaaaccaactacacaatccttcgaatctttt
aaatataattatgcaagtggcaaaaatgattggatgaaagtttatcgtt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA0738 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
fig|451515.3.peg.862 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   FIG01107975: hypothetical protein
fig|451516.9.peg.868 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01107975: hypothetical protein
fig|452948.4.peg.2554 Staphylococcus aureus 930918-3 FIG   FIG01107975: hypothetical protein
fig|455227.3.peg.2164 Staphylococcus aureus D30 FIG   FIG01107975: hypothetical protein
fig|546342.3.peg.2617 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   FIG01107975: hypothetical protein
fig|546343.3.peg.1224 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   FIG01107975: hypothetical protein
fig|553567.3.peg.1664 Staphylococcus aureus A5948 FIG   FIG01107975: hypothetical protein
fig|553590.4.peg.2201 Staphylococcus aureus A9754 FIG   FIG01107975: hypothetical protein
fig|553594.3.peg.2397 Staphylococcus aureus A9765 FIG   FIG01107975: hypothetical protein
fig|644279.4.peg.891 Staphylococcus aureus subsp. aureus 132 FIG   FIG01107975: hypothetical protein
fig|93061.3.peg.791 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01107975: hypothetical protein
gb|ABD29950.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|EEV83202.1 Staphylococcus aureus A5948     predicted protein
gb|EEW44024.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0799
gb|EEW46438.1 Staphylococcus aureus D30     hypothetical protein SAD30_1797
gi|221139564 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_13109
gi|221141198 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_06108
gi|257860370 Staphylococcus aureus A5948 NCBI   predicted protein
gi|258452155 Staphylococcus aureus A5948 NCBI   predicted protein
gi|259158941 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0799
gi|259161853 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1797
gi|87202140 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194582 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00823
img|637893469 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|641771989 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|sao:SAOUHSC_00823 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
ref|YP_499378.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00823
ref|ZP_03564363.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_13109
ref|ZP_03565691.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_06108
ref|ZP_05700171.1 Staphylococcus aureus A5948 RefSeq   predicted protein
tr|Q2G005 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search