The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.720: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phosphoglycerate kinase (EC 2.7.2.3)
Translate Function Assignments



Context on contig NC_007795 from base 773243 to 784459 (11217 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
714 774145 773243 903 -           Cell division inhibitor Slr1223 (YfcH in EC), contains epimerase/dehydratase and DUF1731 domains locus|SAOUHSC_00792, protein_id|YP_499348.1, gi|88194552, geneID|3919355
715 774848 775477 630 + 702         FIG01107882: hypothetical protein locus|SAOUHSC_00793, protein_id|YP_499349.1, gi|88194553, geneID|3919356
716 775711 775607 105 - 129         hypothetical protein  
717 775648 775740 93 + -64         hypothetical protein  
718 776119 777132 1014 + 378 16     Central glycolytic genes regulator locus|SAOUHSC_00794, protein_id|YP_499350.1, gi|88194554, geneID|3919357
719 777185 778195 1011 + 52 21 9: 12 14 17 3 11 18 1 15 9 dlit(20876289) Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) (EC 1.2.1.12) locus|SAOUHSC_00795, protein_id|YP_499351.1, gi|88194555, geneID|3919358
720 778334 779524 1191 + 138   2: 2 1   Phosphoglycerate kinase (EC 2.7.2.3) gene_name|pgk, locus|SAOUHSC_00796, protein_id|YP_499352.1, gi|88194556, geneID|3919359
721 779646 780407 762 + 121 41 4: 2 1 7 4   Triosephosphate isomerase (EC 5.3.1.1) gene_name|tpiA, locus|SAOUHSC_00797, protein_id|YP_499353.1, gi|88194557, geneID|3919360
722 780410 781927 1518 + 2 16 2: 2 1   2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC 5.4.2.12) locus|SAOUHSC_00798, protein_id|YP_499354.1, gi|88194558, geneID|3919361
723 782057 783361 1305 + 129 4 8: 10 16 3 6 2 1 8 13   Enolase (EC 4.2.1.11) gene_name|eno, locus|SAOUHSC_00799, protein_id|YP_499355.1, gi|88194559, geneID|3919362
724 783701 784159 459 + 339         FIG01108117: hypothetical protein locus|SAOUHSC_00800, protein_id|YP_499356.1, gi|88194560, geneID|3919363
725 784226 784459 234 + 66 4 2: 5 4   Protein translocase membrane subunit SecG gene_name|secG, locus|SAOUHSC_00801, protein_id|YP_499357.2, gi|161353529, geneID|3919364

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Glycolysis_and_Gluconeogenesis SvetaG Phosphoglycerate kinase (EC 2.7.2.3)
Glycolytic_pathways_PanGenomes OKPALA_EMMANUEL_user Phosphoglycerate kinase (EC 2.7.2.3)


  Protein Sequence

>fig|93061.5.peg.720 Phosphoglycerate kinase (EC 2.7.2.3)
MAKKIVSDLDLKGKTVLVRADFNVPLKDGEITNDNRIVQALPTIQYIIEQGGKIVLFSHL
GKVKEESDKAKLTLRPVAEDLSKKLDKEVVFVPETRGEKLEAAIKDLKEGDVLLVENTRY
EDLDGKKESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDKEI
KFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVNIADKIIIGGGMAYTFLKAQGKEIGI
SLLEEDKIDFAKDLLEKHGDKIVLPVDTKVAKEFSNDAKITVVPSDSIPADQEGMDIGPN
TVKLFADELEGAHTVVWNGPMGVFEFSNFAQGTIGVCKAIANLKDAITIIGGGDSAAAAI
SLGFENDFTHISTGGGASLEYLEGKELPGIKAINNK

MD5 = b9fba51acf38725067d1e16326ea6955


  DNA Sequence

>fig|93061.5.peg.720 Phosphoglycerate kinase (EC 2.7.2.3)
atggctaaaaaaattgtttctgatttagatcttaaaggtaaaacagtcctagtacgtgct
gattttaacgtacctttaaaagacggtgaaattactaatgacaaccgtatcgttcaagct
ttacctacaattcaatacatcatcgaacaaggtggtaaaatcgtactattttcacattta
ggtaaagtgaaagaagaaagtgataaagcaaaattaactttacgtccagttgctgaagac
ttatctaagaaattagataaagaagttgttttcgtaccagaaacacgcggcgaaaaactt
gaagctgctattaaagaccttaaagaaggcgacgtattattagttgaaaatacacgttat
gaagatttagacggtaaaaaagaatctaaaaatgatccagaattaggtaaatactgggca
tctttaggtgatgtgtttgtaaatgatgcttttggtactgcgcatcgtgagcatgcatct
aatgttggtatttctacacatttagaaactgcagctggattcttaatggataaagaaatt
aagtttattggcggcgtagttaacgatccacataaaccagttgttgctattttaggtgga
gcaaaagtatctgacaaaattaatgtcatcaaaaacttagttaacatagctgataaaatt
atcatcggcggaggtatggcttatactttcttaaaagcgcaaggtaaagaaattggtatt
tcattattagaagaagataaaatcgacttcgcaaaagatttattagaaaaacatggtgat
aaaattgtattaccagtagacactaaagttgctaaagaattttctaatgatgccaaaatc
actgtagtaccatctgattcaattccagcagaccaagaaggtatggatattggaccaaac
actgtaaaattatttgcagatgaattagaaggtgcgcacactgttgtatggaatggacct
atgggtgtattcgagttcagtaactttgcacaaggtacaattggtgtatgtaaagcaatt
gcaaaccttaaagatgcaattacgattatcggtggcggtgattcagctgcagcagcaatc
tctttaggttttgaaaatgacttcactcatatttcaactggtggcggcgcgtcattagag
tacctagaaggtaaagaattgcctggtatcaaagcaatcaataataaataa


  DNA with Flanking Sequence

>fig|93061.5.peg.720 Phosphoglycerate kinase (EC 2.7.2.3)
tcggtaaagttattcctgaaatcgatggtaaattagatggtggtgcacaacgtgttcctg
tagctacaggttcattaactgaattaacagtagtattagaaaaacaagacgtaacagttg
aacaagttaacgaagctatgaaaaatgcttcaaacgaatcattcggttacactgaagacg
aaatcgtttcttcagacgttgtaggtatgacttacggttcattattcgacgctacacaaa
ctcgtgtaatgtcagttggcgaccgtcaattagttaaagttgcagcttggtatgataacg
aaatgtcatatactgcacaattagttcgtacattagcatacttagctgaactttctaaat
aattttagtatagtttttattcaaatacgctagtgctcagaactatttagcattaattaa
agcttatgagtaagcggggagcacaaacgcttctccgcttatttttatataaaatttcct
aattacaaggaggaaacaccatggctaaaaaaattgtttctgatttagatcttaaaggta
aaacagtcctagtacgtgctgattttaacgtacctttaaaagacggtgaaattactaatg
acaaccgtatcgttcaagctttacctacaattcaatacatcatcgaacaaggtggtaaaa
tcgtactattttcacatttaggtaaagtgaaagaagaaagtgataaagcaaaattaactt
tacgtccagttgctgaagacttatctaagaaattagataaagaagttgttttcgtaccag
aaacacgcggcgaaaaacttgaagctgctattaaagaccttaaagaaggcgacgtattat
tagttgaaaatacacgttatgaagatttagacggtaaaaaagaatctaaaaatgatccag
aattaggtaaatactgggcatctttaggtgatgtgtttgtaaatgatgcttttggtactg
cgcatcgtgagcatgcatctaatgttggtatttctacacatttagaaactgcagctggat
tcttaatggataaagaaattaagtttattggcggcgtagttaacgatccacataaaccag
ttgttgctattttaggtggagcaaaagtatctgacaaaattaatgtcatcaaaaacttag
ttaacatagctgataaaattatcatcggcggaggtatggcttatactttcttaaaagcgc
aaggtaaagaaattggtatttcattattagaagaagataaaatcgacttcgcaaaagatt
tattagaaaaacatggtgataaaattgtattaccagtagacactaaagttgctaaagaat
tttctaatgatgccaaaatcactgtagtaccatctgattcaattccagcagaccaagaag
gtatggatattggaccaaacactgtaaaattatttgcagatgaattagaaggtgcgcaca
ctgttgtatggaatggacctatgggtgtattcgagttcagtaactttgcacaaggtacaa
ttggtgtatgtaaagcaattgcaaaccttaaagatgcaattacgattatcggtggcggtg
attcagctgcagcagcaatctctttaggttttgaaaatgacttcactcatatttcaactg
gtggcggcgcgtcattagagtacctagaaggtaaagaattgcctggtatcaaagcaatca
ataataaataataaagtgatagtttaaagtgatgtggcatgtttgtttaacattgttacg
ggaaaacagtcacaagatgacatcgtgtttcatcacttttcaaaaatatttacaaaacaa
ggagtgtctttaatgagaacaccaattatagctggtaactggaaaatgaacaaaacagta
caagaagcaaaagacttcgtcaatacattaccaacactaccagattcaaaagaagtagaa
tcagtaatttgtgcaccagcaattcaattagatgcattaactactgcagttaaagaagga
aaagcacaaggtttagaaatcggtgctcaaaatacgtatttcgaagataatggtgcgttc
acaggtgaaacgtctccagttgcattagcagatttaggcgttaaatacgttgttatcggt
cattctgaacgtcgtgaattattccacgaaacagatgaagaaattaacaaaaaagcgcac
gctattttcaaacatggaatgactccaatta


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004618       F:phosphoglycerate kinase activity
GO:0005524       F:ATP binding
GO:0005737       C:cytoplasm
GO:0006096       P:glycolysis
cmr|NT01SA0785 Staphylococcus aureus N315     phosphoglycerate kinase
cmr|NT02SA0774 Staphylococcus aureus Mu50     phosphoglycerate kinase
cmr|NT03SA0809 Staphylococcus aureus MW2     phosphoglycerate kinase
cmr|NT05SA0712 Staphylococcus aureus NCTC 8325     phosphoglycerate kinase
cmr|NT08SA0813 Staphylococcus aureus subsp. aureus MRSA252     phosphoglycerate kinase
cmr|NT09SA0748 Staphylococcus aureus subsp. aureus MSSA476     phosphoglycerate kinase
cmr|SACOL0839 Staphylococcus aureus subsp. aureus COL     phosphoglycerate kinase
cmr|SAUSA300_0757 Staphylococcus aureus subsp. aureus USA300-FPR3757     phosphoglycerate kinase
dbj|BAB41961.1 Staphylococcus aureus subsp. aureus N315     phosphoglycerate kinase
dbj|BAB56935.1 Staphylococcus aureus subsp. aureus Mu50     phosphoglycerate kinase
dbj|BAB94600.1 Staphylococcus aureus subsp. aureus MW2     phosphoglycerate kinase
dbj|BAF67014.1 Staphylococcus aureus subsp. aureus str. Newman     phosphoglycerate kinase
dbj|BAF77653.1 Staphylococcus aureus subsp. aureus Mu3     phosphoglycerate kinase
emb|CAB38646.1 Staphylococcus aureus EMBL   phosphoglycerate kinase
emb|CAG39838.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   phosphoglycerate kinase
emb|CAG42514.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   phosphoglycerate kinase
fig|158878.1.peg.773 Staphylococcus aureus subsp. aureus Mu50 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|158878.14.peg.795 Staphylococcus aureus subsp. aureus Mu50 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|158879.1.peg.744 Staphylococcus aureus subsp. aureus N315 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|158879.11.peg.772 Staphylococcus aureus subsp. aureus N315 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|196620.1.peg.735 Staphylococcus aureus subsp. aureus MW2 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|196620.5.peg.773 Staphylococcus aureus subsp. aureus MW2 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|282458.1.peg.774 Staphylococcus aureus subsp. aureus MRSA252 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|282458.4.peg.830 Staphylococcus aureus subsp. aureus MRSA252 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|282459.1.peg.733 Staphylococcus aureus subsp. aureus MSSA476 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|282459.5.peg.771 Staphylococcus aureus subsp. aureus MSSA476 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|359786.13.peg.862 Staphylococcus aureus subsp. aureus JH9 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|359786.3.peg.687 Staphylococcus aureus subsp. aureus JH9 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|359787.11.peg.852 Staphylococcus aureus subsp. aureus JH1 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|359787.3.peg.2503 Staphylococcus aureus subsp. aureus JH1 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|367830.3.peg.2249 Staphylococcus aureus subsp. aureus USA300 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|418127.4.peg.724 Staphylococcus aureus subsp. aureus Mu3 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|418127.6.peg.791 Staphylococcus aureus subsp. aureus Mu3 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|426430.6.peg.727 Staphylococcus aureus subsp. aureus str. Newman FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|426430.8.peg.804 Staphylococcus aureus subsp. aureus str. Newman FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|450394.6.peg.1339 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|451515.3.peg.839 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|451516.9.peg.845 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|452948.4.peg.1914 Staphylococcus aureus 930918-3 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|455227.3.peg.2141 Staphylococcus aureus D30 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|505321.3.peg.2848 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|548470.3.peg.1706 Staphylococcus aureus subsp. aureus MN8 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|548473.3.peg.1145 Staphylococcus aureus subsp. aureus TCH60 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|548474.3.peg.1448 Staphylococcus aureus subsp. aureus TCH130 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|548475.3.peg.1077 Staphylococcus aureus subsp. aureus TCH70 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|553565.3.peg.704 Staphylococcus aureus A5937 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|553567.3.peg.1689 Staphylococcus aureus A5948 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|553568.3.peg.1901 Staphylococcus aureus A6224 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|553571.3.peg.793 Staphylococcus aureus A6300 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|553573.3.peg.165 Staphylococcus aureus A8115 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|553574.3.peg.2378 Staphylococcus aureus A8117 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|553577.3.peg.1298 Staphylococcus aureus A8796 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|553580.3.peg.1642 Staphylococcus aureus A8819 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|553581.3.peg.2277 Staphylococcus aureus A9299 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|553583.3.peg.937 Staphylococcus aureus A9635 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|553588.3.peg.1842 Staphylococcus aureus A9719 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|553590.4.peg.2554 Staphylococcus aureus A9754 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|553592.3.peg.2551 Staphylococcus aureus A9763 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|553594.3.peg.1085 Staphylococcus aureus A9765 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|553596.3.peg.1815 Staphylococcus aureus A9781 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|553601.3.peg.363 Staphylococcus aureus A10102 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|585143.3.peg.1298 Staphylococcus aureus subsp. aureus 55/2053 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|585144.3.peg.1656 Staphylococcus aureus subsp. aureus 58-424 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|585145.3.peg.1285 Staphylococcus aureus subsp. aureus 65-1322 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|585146.3.peg.1289 Staphylococcus aureus subsp. aureus 68-397 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|585147.3.peg.368 Staphylococcus aureus subsp. aureus A017934/97 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|585148.3.peg.339 Staphylococcus aureus subsp. aureus Btn1260 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|585149.6.peg.912 Staphylococcus aureus subsp. aureus C101 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|585150.3.peg.1365 Staphylococcus aureus subsp. aureus C160 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|585151.3.peg.402 Staphylococcus aureus subsp. aureus C427 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|585152.3.peg.710 Staphylococcus aureus subsp. aureus D139 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|585153.3.peg.1344 Staphylococcus aureus subsp. aureus E1410 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|585154.3.peg.777 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|585155.3.peg.2137 Staphylococcus aureus subsp. aureus H19 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|585156.3.peg.308 Staphylococcus aureus subsp. aureus M1015 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|585157.3.peg.471 Staphylococcus aureus subsp. aureus M809 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|585158.3.peg.1281 Staphylococcus aureus subsp. aureus M876 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|585159.3.peg.896 Staphylococcus aureus subsp. aureus M899 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|585160.3.peg.304 Staphylococcus aureus subsp. aureus WBG10049 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|585161.3.peg.981 Staphylococcus aureus subsp. aureus WW2703/97 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|585891.3.peg.794 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|644279.4.peg.867 Staphylococcus aureus subsp. aureus 132 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|680649.3.peg.1643 Staphylococcus aureus subsp. aureus MR1 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|703339.3.peg.766 Staphylococcus aureus 04-02981 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|762962.3.peg.1205 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|93061.3.peg.765 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|93062.19.peg.820 Staphylococcus aureus subsp. aureus COL FIG   Phosphoglycerate kinase (EC 2.7.2.3)
fig|93062.4.peg.328 Staphylococcus aureus subsp. aureus COL FIG   Phosphoglycerate kinase (EC 2.7.2.3)
gb|AAW36395.1 Staphylococcus aureus subsp. aureus COL     phosphoglycerate kinase
gb|ABD20896.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     phosphoglycerate kinase
gb|ABD29924.1 Staphylococcus aureus subsp. aureus NCTC 8325     phosphoglycerate kinase, putative
gb|ABQ48600.1 Staphylococcus aureus subsp. aureus JH9     phosphoglycerate kinase
gb|ABR51670.1 Staphylococcus aureus subsp. aureus JH1     Phosphoglycerate kinase
gb|ABX28824.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     phosphoglycerate kinase
gb|EEI96243.1 Staphylococcus aureus subsp. aureus MN8     phosphoglycerate kinase
gb|EEJ62186.1 Staphylococcus aureus subsp. aureus TCH60     phosphoglycerate kinase
gb|EES55345.1 Staphylococcus aureus subsp. aureus TCH70     phosphoglycerate kinase
gb|EES93582.1 Staphylococcus aureus subsp. aureus USA300_TCH959     phosphoglycerate kinase
gb|EES97980.1 Staphylococcus aureus subsp. aureus TCH130     phosphoglycerate kinase
gb|EEV04587.1 Staphylococcus aureus subsp. aureus 55/2053     phosphoglycerate kinase
gb|EEV07228.1 Staphylococcus aureus subsp. aureus 65-1322     phosphoglycerate kinase
gb|EEV09991.1 Staphylococcus aureus subsp. aureus 68-397     phosphoglycerate kinase
gb|EEV12444.1 Staphylococcus aureus subsp. aureus E1410     phosphoglycerate kinase
gb|EEV15108.1 Staphylococcus aureus subsp. aureus M876     phosphoglycerate kinase
gb|EEV27217.1 Staphylococcus aureus A9781     phosphoglycerate kinase
gb|EEV63493.1 Staphylococcus aureus A9763     phosphoglycerate kinase
gb|EEV66869.1 Staphylococcus aureus A9719     phosphoglycerate kinase
gb|EEV70507.1 Staphylococcus aureus A9635     phosphoglycerate kinase
gb|EEV71707.1 Staphylococcus aureus A9299     phosphoglycerate kinase
gb|EEV76369.1 Staphylococcus aureus A8115     phosphoglycerate kinase
gb|EEV78278.1 Staphylococcus aureus A6300     phosphoglycerate kinase
gb|EEV79983.1 Staphylococcus aureus A6224     phosphoglycerate kinase
gb|EEV83226.1 Staphylococcus aureus A5948     phosphoglycerate kinase
gb|EEV86597.1 Staphylococcus aureus A5937     phosphoglycerate kinase
gb|EEW46420.1 Staphylococcus aureus D30     phosphoglycerate kinase
gi|122539968 organism not parsed/found in ncbi nr NCBI   RecName: Full=Phosphoglycerate kinase
gi|123486730 organism not parsed/found in ncbi nr NCBI   RecName: Full=Phosphoglycerate kinase
gi|13700664 Staphylococcus aureus subsp. aureus N315 NCBI   phosphoglycerate kinase
gi|14246542 Staphylococcus aureus subsp. aureus Mu50 NCBI   phosphoglycerate kinase
gi|147740302 Staphylococcus aureus subsp. aureus JH9 NCBI   phosphoglycerate kinase
gi|148267233 Staphylococcus aureus subsp. aureus JH9 NCBI   phosphoglycerate kinase
gi|149945734 Staphylococcus aureus subsp. aureus JH1 NCBI   Phosphoglycerate kinase
gi|150373754 Staphylococcus aureus subsp. aureus str. Newman NCBI   phosphoglycerate kinase
gi|150393282 Staphylococcus aureus subsp. aureus JH1 NCBI   phosphoglycerate kinase
gi|151220954 Staphylococcus aureus subsp. aureus str. Newman NCBI   phosphoglycerate kinase
gi|156721236 Staphylococcus aureus subsp. aureus Mu3 NCBI   phosphoglycerate kinase
gi|156979101 Staphylococcus aureus subsp. aureus Mu3 NCBI   phosphoglycerate kinase
gi|15923763 Staphylococcus aureus subsp. aureus Mu50 NCBI   phosphoglycerate kinase
gi|15926450 Staphylococcus aureus subsp. aureus N315 NCBI   phosphoglycerate kinase
gi|160367853 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   phosphoglycerate kinase
gi|161509044 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   phosphoglycerate kinase
gi|166219336 organism not parsed/found in ncbi nr NCBI   RecName: Full=Phosphoglycerate kinase
gi|172048798 organism not parsed/found in ncbi nr NCBI   RecName: Full=Phosphoglycerate kinase
gi|189036837 organism not parsed/found in ncbi nr NCBI   RecName: Full=Phosphoglycerate kinase
gi|189036838 organism not parsed/found in ncbi nr NCBI   RecName: Full=Phosphoglycerate kinase
gi|189036839 organism not parsed/found in ncbi nr NCBI   RecName: Full=Phosphoglycerate kinase
gi|21203901 Staphylococcus aureus subsp. aureus MW2 NCBI   phosphoglycerate kinase
gi|21282464 Staphylococcus aureus subsp. aureus MW2 NCBI   phosphoglycerate kinase
gi|227246484 Staphylococcus aureus subsp. aureus MN8 NCBI   phosphoglycerate kinase
gi|227557131 Staphylococcus aureus subsp. aureus MN8 NCBI   phosphoglycerate kinase
gi|227852388 Staphylococcus aureus subsp. aureus TCH60 NCBI   phosphoglycerate kinase
gi|227899222 Staphylococcus aureus subsp. aureus TCH60 NCBI   phosphoglycerate kinase
gi|251802688 Staphylococcus aureus subsp. aureus TCH70 NCBI   phosphoglycerate kinase
gi|251813744 Staphylococcus aureus subsp. aureus TCH70 NCBI   phosphoglycerate kinase
gi|253317253 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   phosphoglycerate kinase
gi|253724853 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   phosphoglycerate kinase
gi|253729251 Staphylococcus aureus subsp. aureus TCH130 NCBI   phosphoglycerate kinase
gi|253731403 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   phosphoglycerate kinase
gi|253732777 Staphylococcus aureus subsp. aureus TCH130 NCBI   phosphoglycerate kinase
gi|255005564 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   phosphoglycerate kinase
gi|257272464 Staphylococcus aureus subsp. aureus 55/2053 NCBI   phosphoglycerate kinase
gi|257275755 Staphylococcus aureus subsp. aureus 65-1322 NCBI   phosphoglycerate kinase
gi|257279390 Staphylococcus aureus subsp. aureus 68-397 NCBI   phosphoglycerate kinase
gi|257282309 Staphylococcus aureus subsp. aureus E1410 NCBI   phosphoglycerate kinase
gi|257284989 Staphylococcus aureus subsp. aureus M876 NCBI   phosphoglycerate kinase
gi|257424894 Staphylococcus aureus subsp. aureus 55/2053 NCBI   phosphoglycerate kinase
gi|257427562 Staphylococcus aureus subsp. aureus 65-1322 NCBI   phosphoglycerate kinase
gi|257430193 Staphylococcus aureus subsp. aureus 68-397 NCBI   phosphoglycerate kinase
gi|257432894 Staphylococcus aureus subsp. aureus E1410 NCBI   phosphoglycerate kinase
gi|257435798 Staphylococcus aureus subsp. aureus M876 NCBI   phosphoglycerate kinase
gi|257788877 Staphylococcus aureus A9781 NCBI   phosphoglycerate kinase
gi|257794905 Staphylococcus aureus A9781 NCBI   phosphoglycerate kinase
gi|257839014 Staphylococcus aureus A9763 NCBI   phosphoglycerate kinase
gi|257842445 Staphylococcus aureus A9719 NCBI   phosphoglycerate kinase
gi|257846484 Staphylococcus aureus A9635 NCBI   phosphoglycerate kinase
gi|257847710 Staphylococcus aureus A9299 NCBI   phosphoglycerate kinase
gi|257852448 Staphylococcus aureus A8115 NCBI   phosphoglycerate kinase
gi|257855340 Staphylococcus aureus A6300 NCBI   phosphoglycerate kinase
gi|257857084 Staphylococcus aureus A6224 NCBI   phosphoglycerate kinase
gi|257860394 Staphylococcus aureus A5948 NCBI   phosphoglycerate kinase
gi|257863841 Staphylococcus aureus A5937 NCBI   phosphoglycerate kinase
gi|258418221 Staphylococcus aureus A9763 NCBI   phosphoglycerate kinase
gi|258421519 Staphylococcus aureus A9719 NCBI   phosphoglycerate kinase
gi|258423423 Staphylococcus aureus A9635 NCBI   phosphoglycerate kinase
gi|258439138 Staphylococcus aureus A9299 NCBI   phosphoglycerate kinase
gi|258440934 Staphylococcus aureus A8115 NCBI   phosphoglycerate kinase
gi|258445764 Staphylococcus aureus A6300 NCBI   phosphoglycerate kinase
gi|258449576 Staphylococcus aureus A6224 NCBI   phosphoglycerate kinase
gi|258452179 Staphylococcus aureus A5948 NCBI   phosphoglycerate kinase
gi|258453976 Staphylococcus aureus A5937 NCBI   phosphoglycerate kinase
gi|259161835 Staphylococcus aureus D30 NCBI   phosphoglycerate kinase
gi|4490614 Staphylococcus aureus NCBI   phosphoglycerate kinase
gi|49241160 Staphylococcus aureus subsp. aureus MRSA252 NCBI   phosphoglycerate kinase
gi|49244088 Staphylococcus aureus subsp. aureus MSSA476 NCBI   phosphoglycerate kinase
gi|49483031 Staphylococcus aureus subsp. aureus MRSA252 NCBI   phosphoglycerate kinase
gi|49485645 Staphylococcus aureus subsp. aureus MSSA476 NCBI   phosphoglycerate kinase
gi|56749120 organism not parsed/found in ncbi nr NCBI   RecName: Full=Phosphoglycerate kinase
gi|56749124 organism not parsed/found in ncbi nr NCBI   RecName: Full=Phosphoglycerate kinase
gi|56752700 organism not parsed/found in ncbi nr NCBI   RecName: Full=Phosphoglycerate kinase
gi|56752701 organism not parsed/found in ncbi nr NCBI   RecName: Full=Phosphoglycerate kinase
gi|56752704 organism not parsed/found in ncbi nr NCBI   RecName: Full=Phosphoglycerate kinase
gi|56752705 organism not parsed/found in ncbi nr NCBI   RecName: Full=Phosphoglycerate kinase
gi|57284301 Staphylococcus aureus subsp. aureus COL NCBI   phosphoglycerate kinase
gi|57650115 Staphylococcus aureus subsp. aureus COL NCBI   phosphoglycerate kinase
gi|71153042 organism not parsed/found in ncbi nr NCBI   RecName: Full=Phosphoglycerate kinase
gi|87126382 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   phosphoglycerate kinase
gi|87160408 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   phosphoglycerate kinase
gi|87202114 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   phosphoglycerate kinase, putative
gi|88194556 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   phosphoglycerate kinase
img|637092361 Staphylococcus aureus aureus N315 IMG   phosphoglycerate kinase( EC:2.7.2.3 )
img|637099288 Staphylococcus aureus aureus Mu50 IMG   phosphoglycerate kinase( EC:2.7.2.3 )
img|637151610 Staphylococcus aureus aureus COL IMG   phosphoglycerate kinase( EC:2.7.2.3 )
img|637154277 Staphylococcus aureus aureus MRSA252 IMG   phosphoglycerate kinase( EC:2.7.2.3 )
img|637156967 Staphylococcus aureus aureus MSSA476 IMG   phosphoglycerate kinase( EC:2.7.2.3 )
img|637298496 Staphylococcus aureus aureus MW2 IMG   phosphoglycerate kinase( EC:2.7.2.3 )
img|637887410 Staphylococcus aureus aureus USA300 IMG   phosphoglycerate kinase( EC:2.7.2.3 )
img|637893443 Staphylococcus aureus aureus NCTC 8325 IMG   phosphoglycerate kinase, putative( EC:2.7.2.3 )
img|639108088 Staphylococcus aureus aureus JH1 IMG   Phosphoglycerate kinase( EC:2.7.2.3 )
img|640565148 Staphylococcus aureus aureus JH9 IMG   Phosphoglycerate kinase( EC:2.7.2.3 )
img|640778900 Staphylococcus aureus aureus JH1 IMG   Phosphoglycerate kinase( EC:2.7.2.3 )
img|640795119 Staphylococcus aureus aureus Newman IMG   phosphoglycerate kinase( EC:2.7.2.3 )
img|640903510 Staphylococcus aureus aureus Mu3 IMG   phosphoglycerate kinase( EC:2.7.2.3 )
img|641308771 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   phosphoglycerate kinase( EC:2.7.2.3 )
img|641770971 Staphylococcus aureus aureus USA300_TCH959 IMG   phosphoglycerate kinase( EC:2.7.2.3 )
kegg|saa:SAUSA300_0757 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   phosphoglycerate kinase (EC:2.7.2.3)
kegg|sac:SACOL0839 Staphylococcus aureus subsp. aureus COL KEGG   phosphoglycerate kinase (EC:2.7.2.3)
kegg|sae:NWMN_0742 Staphylococcus aureus subsp. aureus Newman KEGG   phosphoglycerate kinase (EC:2.7.2.3)
kegg|sah:SaurJH1_0814 Staphylococcus aureus subsp. aureus JH1 KEGG   phosphoglycerate kinase (EC:2.7.2.3)
kegg|saj:SaurJH9_0798 Staphylococcus aureus subsp. aureus JH9 KEGG   phosphoglycerate kinase (EC:2.7.2.3)
kegg|sam:MW0735 Staphylococcus aureus subsp. aureus MW2 KEGG   phosphoglycerate kinase (EC:2.7.2.3)
kegg|sao:SAOUHSC_00796 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   phosphoglycerate kinase (EC:2.7.2.3)
kegg|sar:SAR0829   KEGG   phosphoglycerate kinase (EC:2.7.2.3)
kegg|sas:SAS0739   KEGG   phosphoglycerate kinase (EC:2.7.2.3)
kegg|sau:SA0728   KEGG   phosphoglycerate kinase (EC:2.7.2.3)
kegg|sav:SAV0773   KEGG   phosphoglycerate kinase (EC:2.7.2.3)
kegg|saw:SAHV_0770 Staphylococcus aureus subsp. aureus Mu3 KEGG   phosphoglycerate kinase
kegg|sax:USA300HOU_0803 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   phosphoglycerate kinase (EC:2.7.2.3)
ref|NP_371297.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   phosphoglycerate kinase
ref|NP_373983.1 Staphylococcus aureus subsp. aureus N315 RefSeq   phosphoglycerate kinase
ref|NP_645552.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   phosphoglycerate kinase
ref|YP_001246176.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   phosphoglycerate kinase
ref|YP_001315957.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   phosphoglycerate kinase
ref|YP_001331776.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   phosphoglycerate kinase
ref|YP_001441360.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   phosphoglycerate kinase
ref|YP_001574703.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   phosphoglycerate kinase
ref|YP_040255.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   phosphoglycerate kinase
ref|YP_042866.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   phosphoglycerate kinase
ref|YP_185713.1 Staphylococcus aureus subsp. aureus COL RefSeq   phosphoglycerate kinase
ref|YP_493458.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   phosphoglycerate kinase
ref|YP_499352.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   phosphoglycerate kinase
ref|ZP_03987178.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   phosphoglycerate kinase
ref|ZP_04017027.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   phosphoglycerate kinase
ref|ZP_04828217.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   phosphoglycerate kinase
ref|ZP_04840466.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   phosphoglycerate kinase
ref|ZP_04865568.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   phosphoglycerate kinase
ref|ZP_04866942.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   phosphoglycerate kinase
ref|ZP_05144165.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   phosphoglycerate kinase
ref|ZP_05601321.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   phosphoglycerate kinase
ref|ZP_05603961.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   phosphoglycerate kinase
ref|ZP_05606577.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   phosphoglycerate kinase
ref|ZP_05609254.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   phosphoglycerate kinase
ref|ZP_05611846.1 Staphylococcus aureus subsp. aureus M876 RefSeq   phosphoglycerate kinase
ref|ZP_05643884.1 Staphylococcus aureus A9781 RefSeq   phosphoglycerate kinase
ref|ZP_05682486.1 Staphylococcus aureus A9763 RefSeq   phosphoglycerate kinase
ref|ZP_05684444.1 Staphylococcus aureus A9719 RefSeq   phosphoglycerate kinase
ref|ZP_05686314.1 Staphylococcus aureus A9635 RefSeq   phosphoglycerate kinase
ref|ZP_05690182.1 Staphylococcus aureus A9299 RefSeq   phosphoglycerate kinase
ref|ZP_05690769.1 Staphylococcus aureus A8115 RefSeq   phosphoglycerate kinase
ref|ZP_05693941.1 Staphylococcus aureus A6300 RefSeq   phosphoglycerate kinase
ref|ZP_05697678.1 Staphylococcus aureus A6224 RefSeq   phosphoglycerate kinase
ref|ZP_05700195.1 Staphylococcus aureus A5948 RefSeq   phosphoglycerate kinase
ref|ZP_05701948.1 Staphylococcus aureus A5937 RefSeq   phosphoglycerate kinase
sp|A5IQX7 Staphylococcus aureus (strain JH9) SwissProt   Phosphoglycerate kinase
sp|A6QF82 Staphylococcus aureus (strain Newman) SwissProt   Phosphoglycerate kinase
sp|A6TZQ2 Staphylococcus aureus (strain JH1) SwissProt   Phosphoglycerate kinase
sp|A7WZS6 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   Phosphoglycerate kinase
sp|A8Z1A1 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   Phosphoglycerate kinase
sp|P68819 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   Phosphoglycerate kinase
sp|P68820 Staphylococcus aureus SwissProt   Phosphoglycerate kinase
sp|P68821 Staphylococcus aureus (strain MW2) SwissProt   Phosphoglycerate kinase
sp|P99135 Staphylococcus aureus (strain N315) SwissProt   Phosphoglycerate kinase
sp|PGK_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Phosphoglycerate kinase
sp|PGK_STAA2 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Phosphoglycerate kinase
sp|PGK_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Phosphoglycerate kinase
sp|PGK_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Phosphoglycerate kinase
sp|PGK_STAA9 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Phosphoglycerate kinase
sp|PGK_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Phosphoglycerate kinase
sp|PGK_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=Phosphoglycerate kinase
sp|PGK_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=Phosphoglycerate kinase
sp|PGK_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=Phosphoglycerate kinase
sp|PGK_STAAR organism not parsed/found in ncbi nr SwissProt   RecName: Full=Phosphoglycerate kinase
sp|PGK_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=Phosphoglycerate kinase
sp|PGK_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=Phosphoglycerate kinase
sp|PGK_STAAU organism not parsed/found in ncbi nr SwissProt   RecName: Full=Phosphoglycerate kinase
sp|PGK_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=Phosphoglycerate kinase
sp|Q2FIM0 Staphylococcus aureus (strain USA300) SwissProt   Phosphoglycerate kinase
sp|Q2G031 Staphylococcus aureus (strain NCTC 8325) SwissProt   Phosphoglycerate kinase
sp|Q5HHP4 Staphylococcus aureus (strain COL) SwissProt   Phosphoglycerate kinase
sp|Q6GB57 Staphylococcus aureus (strain MSSA476) SwissProt   Phosphoglycerate kinase
sp|Q6GIL7 Staphylococcus aureus (strain MRSA252) SwissProt   Phosphoglycerate kinase
tr|C2G9J4 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   Phosphoglycerate kinase
tr|C2K4Y8 Staphylococcus aureus subsp. aureus MN8 TrEMBL   Phosphoglycerate kinase
tr|C5N3M6 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Phosphoglycerate kinase
tr|C5PYH3 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Phosphoglycerate kinase
tr|C5QHF1 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Phosphoglycerate kinase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
16 fig|93061.5.peg.718 Central glycolytic genes regulator
21 fig|93061.5.peg.719 Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) (EC 1.2.1.12)
41 fig|93061.5.peg.721 Triosephosphate isomerase (EC 5.3.1.1)
16 fig|93061.5.peg.722 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC 5.4.2.12)
4 fig|93061.5.peg.723 Enolase (EC 4.2.1.11)
4 fig|93061.5.peg.725 Protein translocase membrane subunit SecG


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search