The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.689: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: FIG005590: DegV family protein
Translate Function Assignments



Context on contig NC_007795 from base 740290 to 752471 (12182 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
683 741516 740290 1227 -       5: 9 8 3 13 14   Tripeptide aminopeptidase (EC 3.4.11.4) locus|SAOUHSC_00757, protein_id|YP_499316.1, gi|88194521, geneID|3919518
684 741922 741530 393 - 13         Integral membrane protein locus|SAOUHSC_00758, protein_id|YP_499317.1, gi|88194522, geneID|3919519
685 742803 742042 762 - 119         YjjP-like membrane protein SAV0745 locus|SAOUHSC_00759, protein_id|YP_499318.1, gi|88194523, geneID|3919520
686 744069 742999 1071 - 195         GGDEF domain-containing protein locus|SAOUHSC_00760, protein_id|YP_499319.1, gi|88194524, geneID|3919521
687 744387 745442 1056 + 317     3: 6 11 7 dlit(16740924) Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.33) locus|SAOUHSC_00762, protein_id|YP_499320.1, gi|88194525, geneID|3919522
688 746253 745612 642 - 169     2: 10 17   IMPACT family member YigZ locus|SAOUHSC_00763, protein_id|YP_499321.1, gi|88194526, geneID|3919523
689 746397 746780 384 + 143         FIG005590: DegV family protein locus|SAOUHSC_00764, protein_id|YP_499322.1, gi|88194527, geneID|3919524
690 747288 748226 939 + 507     2: 2 1   ComF operon protein A, DNA transporter ATPase locus|SAOUHSC_00765, protein_id|YP_499323.1, gi|88194528, geneID|3919057
691 748219 748893 675 + -8     2: 2 1   DNA utilization protein YhgH locus|SAOUHSC_00766, protein_id|YP_499324.1, gi|88194529, geneID|3919058
692 748954 749526 573 + 60     2: 16 4 dlit(27001516) Ribosome hibernation promoting factor Hpf locus|SAOUHSC_00767, protein_id|YP_499325.1, gi|88194530, geneID|3919059
693 749940 752471 2532 + 413     3: 5 15 12   Protein translocase subunit SecA gene_name|secA, locus|SAOUHSC_00769, protein_id|YP_499326.1, gi|88194531, geneID|3919060

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.689 FIG005590: DegV family protein
MKIAVMTDSTSYLSQDLIDKYNIQIAPLSVTFEDGKIIPEEKVRTKKRAIQTLEKKVLDI
VKDFEEVTLFVINGDHFEDGQALYKKLQDDCPSAYQVAYSEFGPVVAAHLGSGGLGLGYV
GRKIRLT

MD5 = 5d958bc23f10562ae93db2d70303cc0d


  DNA Sequence

>fig|93061.5.peg.689 FIG005590: DegV family protein
atgaaaattgctgtgatgaccgattctacaagttatctgtcgcaggacttaatcgataaa
tataatattcaaatagcgccattaagtgtgacttttgaagatggcaagattataccagaa
gaaaaagttcgtactaaaaagcgtgccattcaaacattagaaaagaaagtattagatatt
gtaaaagactttgaagaagtaactttatttgtcataaatggagatcatttcgaagatggt
caagcgttatacaaaaagttacaagatgattgtccttcagcttatcaagtagcatactct
gagtttggtccagttgttgcagcacatttaggttctggtggattaggtttaggctatgtt
ggcagaaaaataagattaacataa


  DNA with Flanking Sequence

>fig|93061.5.peg.689 FIG005590: DegV family protein
agcaccgctataggcgcgaattaaaccgccaccacctaatttaataccaccaaaatatct
tgttactacgacacacgcattatgaacatcgagcttttttaatatgtctaacattgggac
accggcagttcctgtcggttcaccatcatcattcgctttttgaatattcatttcaggtcc
aatagtatatgcagaacaattatgagtggcatctttatgttctttttttattgcagcaat
aaatgctttagcttcatcttcattttgaacaggtttgatatgagcaatgaatcttgattt
actaatcacattttcaataatgtgttcttttttaacagtaatgatattttgtgtcataat
aactccttaattcataagcttaagattatttaatcttcattatacactgaaaatgacatg
actataaatcgtttgattgccattttctttttaactgaaatattgtatcattgctatgag
tatattttaggaggacgactatgaaaattgctgtgatgaccgattctacaagttatctgt
cgcaggacttaatcgataaatataatattcaaatagcgccattaagtgtgacttttgaag
atggcaagattataccagaagaaaaagttcgtactaaaaagcgtgccattcaaacattag
aaaagaaagtattagatattgtaaaagactttgaagaagtaactttatttgtcataaatg
gagatcatttcgaagatggtcaagcgttatacaaaaagttacaagatgattgtccttcag
cttatcaagtagcatactctgagtttggtccagttgttgcagcacatttaggttctggtg
gattaggtttaggctatgttggcagaaaaataagattaacataattataaaattttaata
aaagagtctatattgtaattggaaattatctctcgtatacatggctttaaatgttcatca
tttgaaagccaaaatgctaaagatataagaaaatcattataatattaggctcttttttac
gttgaaatgaggttttaagcattaaacattacgggaaattaattcatcctcatacttcac
ttactaatgaaaaaattaaaaaagaagtaacaggtgtcatcaaacaaaattcaaactatt
attgtgttcaatgtgaaagtacaaatccaaagcatttttatcagtatgattcctcagtac
attccaagaaaattgtatattgcagaaattgtatatcactgggtcgaatggataatgtaa
caagatataaaataacagagagttcgcaaagttcatcacaagcatattatcatctctcat
ttgaattgtcggaacagcagtcttatgcctcagaacatattgttcgagccattagaaaga
gaca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA0685 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
fig|93061.3.peg.736 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG005590: DegV family protein
gb|ABD29895.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gi|87202085 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194527 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00764
img|637893412 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
kegg|sao:SAOUHSC_00764 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
ref|YP_499322.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00764
tr|Q2G058 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search