The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.673: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Iron compound ABC uptake transporter permease protein
Translate Function Assignments



Context on contig NC_007795 from base 726781 to 737080 (10300 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
670 726781 727179 399 +       1: 3   Ribonucleotide reduction protein NrdI gene_name|nrdI, locus|SAOUHSC_00741, protein_id|YP_499301.1, gi|88194506, geneID|3920986
671 727142 729247 2106 + -38     2: 3 5   Ribonucleotide reductase of class Ib (aerobic), alpha subunit (EC 1.17.4.1) locus|SAOUHSC_00742, protein_id|YP_499302.1, gi|88194507, geneID|3920987
672 729365 730336 972 + 117     1: 3   Ribonucleotide reductase of class Ib (aerobic), beta subunit (EC 1.17.4.1) gene_name|nrdF, locus|SAOUHSC_00743, protein_id|YP_499303.1, gi|88194508, geneID|3920988
673 731044 732015 972 + 707   2: 1 2   Iron compound ABC uptake transporter permease protein locus|SAOUHSC_00746, protein_id|YP_499306.1, gi|88194511, geneID|3919508
674 732002 732958 957 + -14 36 2: 1 2   Iron compound ABC uptake transporter permease protein locus|SAOUHSC_00747, protein_id|YP_499307.1, gi|88194512, geneID|3919509
675 732955 733716 762 + -4 46 3: 1 2 4   Iron compound ABC uptake transporter ATP-binding protein locus|SAOUHSC_00748, protein_id|YP_499308.1, gi|88194513, geneID|3919510
676 733835 734863 1029 + 118 40 2: 1 2   Iron compound ABC uptake transporter substrate-binding protein locus|SAOUHSC_00749, protein_id|YP_499309.1, gi|88194514, geneID|3919511
677 735500 735180 321 - 316         FIG01108317: hypothetical protein locus|SAOUHSC_00751, protein_id|YP_499310.1, gi|88194515, geneID|3919512
678 736435 735512 924 - 11     2: 6 7   UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158) gene_name|murB, locus|SAOUHSC_00752, protein_id|YP_499311.1, gi|88194516, geneID|3919513
679 737080 736562 519 - 126         FIG01108570: hypothetical protein locus|SAOUHSC_00753, protein_id|YP_499312.1, gi|88194517, geneID|3919514

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Iron_acquisition_in_Streptococcus SvetaG Iron compound ABC uptake transporter permease protein
Heme,_hemin_uptake_and_utilization_systems_in_GramPositives SvetaG Iron compound ABC uptake transporter permease protein


  Protein Sequence

>fig|93061.5.peg.673 Iron compound ABC uptake transporter permease protein
MKYLLKGNILLLLLILLTIISLFIGVSELSIKDLLHLTESQRNILFSSRIPRTMSILIAG
SSLALAGLIMQQMMQNKFVSPTTAGTMEWAKLGILIALLFFPTGHILLKLVFAVICSICG
TFLFVKIIDFIKVKDVIFVPLLGIMMGGIVASFTTFISLRTNAVQSIGNWLNGNFAIITS
GRYEILYLSIPLLALTYLFANHFTIVGMGKDFTNNLGLSYEKLINIALFITATITALVVV
TVGTLPFLGLVIPNIISIYRGDHLKNAIPHTMMLGAIFVLFSDIVGRIVVYPYEINIGLT
IGVFGTIIFLILLMKGRKNYAQQ

MD5 = a7f41dc0398a42d4cf5c4ea782dbaeb4


  DNA Sequence

>fig|93061.5.peg.673 Iron compound ABC uptake transporter permease protein
atgaagtatttattaaagggaaatattttgcttctattactaatattgttgacaattatt
tcgttgttcataggtgtgagtgaactatcaattaaagatttactacatttaactgagtca
cagcggaatattttattctcaagccgaataccaaggacgatgagtattttaattgctgga
agttcgttggctttagcaggcttgataatgcaacaaatgatgcaaaataagtttgttagt
ccgactacagctggaacgatggaatgggctaaactaggtattttaattgctttattgttc
tttccaaccggtcatattttattaaaactagtatttgctgttatttgcagtatttgcggt
acgtttttatttgttaaaatcattgattttataaaagtgaaagatgtcatttttgtaccg
cttttaggaattatgatgggtgggattgttgcaagtttcacaaccttcatctcattgcgc
acgaatgctgttcaaagcattggtaactggcttaacgggaactttgccattatcacaagt
ggacgctatgaaattttatatttaagtattcctcttttagcattgacatatctttttgct
aatcatttcacgattgtaggaatgggtaaagactttactaataatttaggtttgagttac
gaaaaattaattaacatcgcattgtttattactgcaactattacagcattggtagtggtg
actgttggaacattaccgttcttaggactagtaataccaaatattatttcaatttatcga
ggtgatcatttgaaaaatgctatccctcatacgatgatgttaggtgccatctttgtatta
ttttctgatatagttggcagaattgttgtttatccatatgaaataaatattggtttaaca
ataggtgtatttggaacaatcattttccttatcttgcttatgaaaggtaggaaaaattat
gcgcaacaataa


  DNA with Flanking Sequence

>fig|93061.5.peg.673 Iron compound ABC uptake transporter permease protein
attgtgcaagttggcggggccccaacatagaagcaggcggaaagtcagctaacaataatg
tgcaagttggcggggccccaacataaaagcaggcggaaagtcagctaacaatattgtgca
agttcgggcggggccccaacataaagaaaaactttttcctttagaaattatcacttccac
atgagttttactcatgtattcctatttttaagtacacattagctgaggctaatgttaaga
accactacttaatcaatcattagtagtttttatcatttccactattcccagacatcaaaa
tcttaagtgttctattttactttaagtaaacaaaatacacattccgaaaaattaaatttc
agtttaattgcaaatatcaataaaattgacactaaattatttgaaaggctattgaaatta
tggtcaaaaaacgctactattaatgagaaatattatcaatgataatgattatcattaatt
taaagggagaaaaatttgtaatgaagtatttattaaagggaaatattttgcttctattac
taatattgttgacaattatttcgttgttcataggtgtgagtgaactatcaattaaagatt
tactacatttaactgagtcacagcggaatattttattctcaagccgaataccaaggacga
tgagtattttaattgctggaagttcgttggctttagcaggcttgataatgcaacaaatga
tgcaaaataagtttgttagtccgactacagctggaacgatggaatgggctaaactaggta
ttttaattgctttattgttctttccaaccggtcatattttattaaaactagtatttgctg
ttatttgcagtatttgcggtacgtttttatttgttaaaatcattgattttataaaagtga
aagatgtcatttttgtaccgcttttaggaattatgatgggtgggattgttgcaagtttca
caaccttcatctcattgcgcacgaatgctgttcaaagcattggtaactggcttaacggga
actttgccattatcacaagtggacgctatgaaattttatatttaagtattcctcttttag
cattgacatatctttttgctaatcatttcacgattgtaggaatgggtaaagactttacta
ataatttaggtttgagttacgaaaaattaattaacatcgcattgtttattactgcaacta
ttacagcattggtagtggtgactgttggaacattaccgttcttaggactagtaataccaa
atattatttcaatttatcgaggtgatcatttgaaaaatgctatccctcatacgatgatgt
taggtgccatctttgtattattttctgatatagttggcagaattgttgtttatccatatg
aaataaatattggtttaacaataggtgtatttggaacaatcattttccttatcttgctta
tgaaaggtaggaaaaattatgcgcaacaataataaaaaaataatgcttttaattgcagta
acgttattaattagtatgctgtacttatttgtaggtattgattttgaaatatttgaatat
caattttcaagtcgtttaagaaagttcatattaattattttagtaggtgctgccattgca
acttcagtggtgatttttcaagcgattacaaataaccgtctattgacaccatcaataatg
gggttagatgcagtttatttatttatcaaagtattgccagtctttttatttggaattcaa
tcggtatgggttactaatgtatatttgaactttatattaacacttataacgatggtgtta
ttcgcactaatcctattccaaggtatctttaaaatcggacatttttcaatttattttatc
ttacttattggtgtccttttaggaacattttttagaagcataacaggttttattcaactg
attatggatcctgagtcatttttagcaatacaaagtagtatgtttgctaatt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005215       F:transporter activity
GO:0005886       C:plasma membrane
GO:0006810       P:transport
GO:0016021       C:integral to membrane
cmr|NT01SA0739 Staphylococcus aureus N315     Unknown
cmr|NT02SA0734 Staphylococcus aureus Mu50     membrane protein
cmr|NT03SA0766 Staphylococcus aureus MW2     iron compound ABC transporter, permease protein
cmr|NT05SA0670 Staphylococcus aureus NCTC 8325     ttg start
cmr|NT09SA0708 Staphylococcus aureus subsp. aureus MSSA476     membrane protein
cmr|SACOL0796 Staphylococcus aureus subsp. aureus COL     iron compound ABC transporter, permease protein
cmr|SAUSA300_0718 Staphylococcus aureus subsp. aureus USA300-FPR3757     iron compound ABC transporter, permease
dbj|BAB41921.1 Staphylococcus aureus subsp. aureus N315     SA0688
dbj|BAB56895.1 Staphylococcus aureus subsp. aureus Mu50     ferrichrome ABC transporter permease
dbj|BAB94560.1 Staphylococcus aureus subsp. aureus MW2     MW0695
dbj|BAF66974.1 Staphylococcus aureus subsp. aureus str. Newman     ferrichrome ABC transporter permease
dbj|BAF77613.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
emb|CAG42474.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   FecCD transport family protein
fig|158878.1.peg.733 Staphylococcus aureus subsp. aureus Mu50 FIG   Iron compound ABC uptake transporter permease protein
fig|158878.14.peg.750 Staphylococcus aureus subsp. aureus Mu50 FIG   Iron compound ABC uptake transporter permease protein
fig|158879.1.peg.704 Staphylococcus aureus subsp. aureus N315 FIG   Iron compound ABC uptake transporter permease protein
fig|158879.11.peg.727 Staphylococcus aureus subsp. aureus N315 FIG   Iron compound ABC uptake transporter permease protein
fig|196620.1.peg.695 Staphylococcus aureus subsp. aureus MW2 FIG   Iron compound ABC uptake transporter permease protein
fig|196620.5.peg.732 Staphylococcus aureus subsp. aureus MW2 FIG   Iron compound ABC uptake transporter permease protein
fig|282459.1.peg.693 Staphylococcus aureus subsp. aureus MSSA476 FIG   Iron compound ABC uptake transporter permease protein
fig|359786.13.peg.819 Staphylococcus aureus subsp. aureus JH9 FIG   Iron compound ABC uptake transporter permease protein
fig|359786.3.peg.2544 Staphylococcus aureus subsp. aureus JH9 FIG   Iron compound ABC uptake transporter permease protein
fig|359787.11.peg.810 Staphylococcus aureus subsp. aureus JH1 FIG   Iron compound ABC uptake transporter permease protein
fig|359787.3.peg.2353 Staphylococcus aureus subsp. aureus JH1 FIG   Iron compound ABC uptake transporter permease protein
fig|367830.3.peg.1684 Staphylococcus aureus subsp. aureus USA300 FIG   Iron compound ABC uptake transporter permease protein
fig|418127.4.peg.686 Staphylococcus aureus subsp. aureus Mu3 FIG   Iron compound ABC uptake transporter permease protein
fig|418127.6.peg.746 Staphylococcus aureus subsp. aureus Mu3 FIG   Iron compound ABC uptake transporter permease protein
fig|426430.6.peg.689 Staphylococcus aureus subsp. aureus str. Newman FIG   Iron compound ABC uptake transporter permease protein
fig|426430.8.peg.758 Staphylococcus aureus subsp. aureus str. Newman FIG   Iron compound ABC uptake transporter permease protein
fig|450394.6.peg.1296 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Iron compound ABC uptake transporter permease protein
fig|451515.3.peg.795 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Iron compound ABC uptake transporter permease protein
fig|451516.9.peg.799 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Iron compound ABC uptake transporter permease protein
fig|452948.4.peg.1486 Staphylococcus aureus 930918-3 FIG   Iron compound ABC uptake transporter permease protein
fig|505321.3.peg.1344 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Iron compound ABC uptake transporter permease protein
fig|546342.3.peg.623 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Iron compound ABC uptake transporter permease protein
fig|546343.3.peg.448 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Iron compound ABC uptake transporter permease protein
fig|548474.3.peg.1489 Staphylococcus aureus subsp. aureus TCH130 FIG   Iron compound ABC uptake transporter permease protein
fig|548475.3.peg.1036 Staphylococcus aureus subsp. aureus TCH70 FIG   Iron compound ABC uptake transporter permease protein
fig|553565.3.peg.746 Staphylococcus aureus A5937 FIG   Iron compound ABC uptake transporter permease protein
fig|553567.3.peg.2443 Staphylococcus aureus A5948 FIG   Iron compound ABC uptake transporter permease protein
fig|553568.3.peg.1943 Staphylococcus aureus A6224 FIG   Iron compound ABC uptake transporter permease protein
fig|553571.3.peg.837 Staphylococcus aureus A6300 FIG   Iron compound ABC uptake transporter permease protein
fig|553573.3.peg.439 Staphylococcus aureus A8115 FIG   Iron compound ABC uptake transporter permease protein
fig|553574.3.peg.1837 Staphylococcus aureus A8117 FIG   Iron compound ABC uptake transporter permease protein
fig|553577.3.peg.1254 Staphylococcus aureus A8796 FIG   Iron compound ABC uptake transporter permease protein
fig|553580.3.peg.1599 Staphylococcus aureus A8819 FIG   Iron compound ABC uptake transporter permease protein
fig|553588.3.peg.1885 Staphylococcus aureus A9719 FIG   Iron compound ABC uptake transporter permease protein
fig|553590.4.peg.2568 Staphylococcus aureus A9754 FIG   Iron compound ABC uptake transporter permease protein
fig|553592.3.peg.2595 Staphylococcus aureus A9763 FIG   Iron compound ABC uptake transporter permease protein
fig|553596.3.peg.1856 Staphylococcus aureus A9781 FIG   Iron compound ABC uptake transporter permease protein
fig|553601.3.peg.320 Staphylococcus aureus A10102 FIG   Iron compound ABC uptake transporter permease protein
fig|585891.3.peg.749 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Iron compound ABC uptake transporter permease protein
fig|644279.4.peg.821 Staphylococcus aureus subsp. aureus 132 FIG   Iron compound ABC uptake transporter permease protein
fig|680649.3.peg.473 Staphylococcus aureus subsp. aureus MR1 FIG   Iron compound ABC uptake transporter permease protein
fig|681288.4.peg.696 Staphylococcus aureus subsp. aureus ED98 FIG   Iron compound ABC uptake transporter permease protein
fig|703339.3.peg.723 Staphylococcus aureus 04-02981 FIG   Iron compound ABC uptake transporter permease protein
fig|762962.3.peg.1246 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Iron compound ABC uptake transporter permease protein
fig|93061.3.peg.719 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Iron compound ABC uptake transporter permease protein
fig|93062.19.peg.776 Staphylococcus aureus subsp. aureus COL FIG   Iron compound ABC uptake transporter permease protein
fig|93062.4.peg.282 Staphylococcus aureus subsp. aureus COL FIG   Iron compound ABC uptake transporter permease protein
gb|AAW37851.1 Staphylococcus aureus subsp. aureus COL     iron compound ABC transporter, permease protein
gb|ABD21862.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     iron compound ABC transporter, permease
gb|ABD29879.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ48560.1 Staphylococcus aureus subsp. aureus JH9     transport system permease protein
gb|ABR51630.1 Staphylococcus aureus subsp. aureus JH1     transport system permease protein
gb|EEV27258.1 Staphylococcus aureus A9781     ABC iron transporter membrane protein
gb|EEV63534.1 Staphylococcus aureus A9763     ABC iron transporter membrane protein
gb|EEV66909.1 Staphylococcus aureus A9719     iron ABC transporter membrane protein
gb|EEV76150.1 Staphylococcus aureus A8115     Iron ABC transporter membrane protein
gb|EEV78319.1 Staphylococcus aureus A6300     iron ABC transporter membrane protein
gb|EEV80023.1 Staphylococcus aureus A6224     iron ABC transporter membrane protein
gb|EEV82306.1 Staphylococcus aureus A5948     iron compound ABC transporter
gb|EEV86637.1 Staphylococcus aureus A5937     iron compound ABC transporter
gb|EEW44801.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1046
gb|EEW46925.1 Staphylococcus aureus D30     hypothetical protein SAD30_0939
gi|13700624 Staphylococcus aureus subsp. aureus N315 NCBI   SA0688
gi|14246502 Staphylococcus aureus subsp. aureus Mu50 NCBI   ferrichrome ABC transporter permease
gi|147740262 Staphylococcus aureus subsp. aureus JH9 NCBI   transport system permease protein
gi|148267193 Staphylococcus aureus subsp. aureus JH9 NCBI   transport system permease protein
gi|149945694 Staphylococcus aureus subsp. aureus JH1 NCBI   transport system permease protein
gi|150373714 Staphylococcus aureus subsp. aureus str. Newman NCBI   ferrichrome ABC transporter permease
gi|150393242 Staphylococcus aureus subsp. aureus JH1 NCBI   transport system permease protein
gi|151220914 Staphylococcus aureus subsp. aureus str. Newman NCBI   ferrichrome ABC transporter permease
gi|156721196 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156979061 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0730
gi|15923723 Staphylococcus aureus subsp. aureus Mu50 NCBI   ferrichrome ABC transporter permease
gi|15926410 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0688
gi|21203861 Staphylococcus aureus subsp. aureus MW2 NCBI   MW0695
gi|21282424 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW0695
gi|221137640 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   iron (Fe+3) ABC transporter membrane protein
gi|221140440 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   iron (Fe+3) ABC transporter membrane protein
gi|253315834 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   iron (Fe+3) ABC transporter membrane protein
gi|257788918 Staphylococcus aureus A9781 NCBI   ABC iron transporter membrane protein
gi|257794946 Staphylococcus aureus A9781 NCBI   ABC iron transporter membrane protein
gi|257839055 Staphylococcus aureus A9763 NCBI   ABC iron transporter membrane protein
gi|257842485 Staphylococcus aureus A9719 NCBI   iron ABC transporter membrane protein
gi|257852223 Staphylococcus aureus A8115 NCBI   Iron ABC transporter membrane protein
gi|257855381 Staphylococcus aureus A6300 NCBI   iron ABC transporter membrane protein
gi|257857124 Staphylococcus aureus A6224 NCBI   iron ABC transporter membrane protein
gi|257859452 Staphylococcus aureus A5948 NCBI   iron compound ABC transporter
gi|257863881 Staphylococcus aureus A5937 NCBI   iron compound ABC transporter
gi|258418262 Staphylococcus aureus A9763 NCBI   ABC iron transporter membrane protein
gi|258421559 Staphylococcus aureus A9719 NCBI   iron ABC transporter membrane protein
gi|258441754 Staphylococcus aureus A8115 NCBI   Iron ABC transporter membrane protein
gi|258445805 Staphylococcus aureus A6300 NCBI   iron ABC transporter membrane protein
gi|258449616 Staphylococcus aureus A6224 NCBI   iron ABC transporter membrane protein
gi|258452941 Staphylococcus aureus A5948 NCBI   iron compound ABC transporter
gi|258454016 Staphylococcus aureus A5937 NCBI   iron compound ABC transporter
gi|259159760 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1046
gi|259162353 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0939
gi|49244048 Staphylococcus aureus subsp. aureus MSSA476 NCBI   FecCD transport family protein
gi|49485605 Staphylococcus aureus subsp. aureus MSSA476 NCBI   FecCD transport family protein
gi|57285757 Staphylococcus aureus subsp. aureus COL NCBI   iron compound ABC transporter, permease protein
gi|57651571 Staphylococcus aureus subsp. aureus COL NCBI   iron compound ABC transporter, permease protein
gi|87127348 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   iron compound ABC transporter, permease
gi|87161374 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   iron compound ABC transporter, permease
gi|87202069 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194511 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00746
img|637092320 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099247 Staphylococcus aureus aureus Mu50 IMG   ferrichrome ABC transporter permease
img|637151566 Staphylococcus aureus aureus COL IMG   iron compound ABC transporter, permease protein
img|637156926 Staphylococcus aureus aureus MSSA476 IMG   FecCD transport family protein
img|637298455 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637887372 Staphylococcus aureus aureus USA300 IMG   iron compound ABC transporter, permease
img|637893396 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639108047 Staphylococcus aureus aureus JH1 IMG   transport system permease protein
img|640565107 Staphylococcus aureus aureus JH9 IMG   transport system permease protein
img|640778859 Staphylococcus aureus aureus JH1 IMG   transport system permease protein
img|640795078 Staphylococcus aureus aureus Newman IMG   ferrichrome ABC transporter permease
img|640903469 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641771659 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_0718 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   iron compound ABC transporter, permease
kegg|sac:SACOL0796 Staphylococcus aureus subsp. aureus COL KEGG   iron compound ABC transporter, permease protein
kegg|sae:NWMN_0702 Staphylococcus aureus subsp. aureus Newman KEGG   ferrichrome ABC transporter permease
kegg|sah:SaurJH1_0774 Staphylococcus aureus subsp. aureus JH1 KEGG   transport system permease protein
kegg|saj:SaurJH9_0757 Staphylococcus aureus subsp. aureus JH9 KEGG   transport system permease protein
kegg|sam:MW0695 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_00746 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS0698   KEGG   FecCD transport family protein
kegg|sau:SA0688   KEGG   hypothetical protein
kegg|sav:SAV0733   KEGG   ferrichrome ABC transporter permease
kegg|saw:SAHV_0730 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_371257.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   ferrichrome ABC transporter permease
ref|NP_373943.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0688
ref|NP_645512.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW0695
ref|YP_001246136.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   transport system permease protein
ref|YP_001315917.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   transport system permease protein
ref|YP_001331736.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   ferrichrome ABC transporter permease
ref|YP_001441320.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0730
ref|YP_042826.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   FecCD transport family protein
ref|YP_185670.1 Staphylococcus aureus subsp. aureus COL RefSeq   iron compound ABC transporter, permease protein
ref|YP_493421.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   iron compound ABC transporter, permease
ref|YP_499306.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00746
ref|ZP_03562446.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   iron (Fe+3) ABC transporter membrane protein
ref|ZP_03564933.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   iron (Fe+3) ABC transporter membrane protein
ref|ZP_04839047.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   iron (Fe+3) ABC transporter membrane protein
ref|ZP_05643925.1 Staphylococcus aureus A9781 RefSeq   ABC iron transporter membrane protein
ref|ZP_05682527.1 Staphylococcus aureus A9763 RefSeq   ABC iron transporter membrane protein
ref|ZP_05684484.1 Staphylococcus aureus A9719 RefSeq   iron ABC transporter membrane protein
ref|ZP_05691026.1 Staphylococcus aureus A8115 RefSeq   Iron ABC transporter membrane protein
ref|ZP_05693982.1 Staphylococcus aureus A6300 RefSeq   iron ABC transporter membrane protein
ref|ZP_05697718.1 Staphylococcus aureus A6224 RefSeq   iron ABC transporter membrane protein
ref|ZP_05700935.1 Staphylococcus aureus A5948 RefSeq   iron compound ABC transporter
ref|ZP_05701988.1 Staphylococcus aureus A5937 RefSeq   iron compound ABC transporter
tr|A5IQT7 Staphylococcus aureus (strain JH9) TrEMBL   Transport system permease protein precursor
tr|A6QF42 Staphylococcus aureus (strain Newman) TrEMBL   Ferrichrome ABC transporter permease
tr|A6TZL2 Staphylococcus aureus (strain JH1) TrEMBL   Transport system permease protein precursor
tr|A7WZM2 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|Q2FIQ7 Staphylococcus aureus (strain USA300) TrEMBL   Iron compound ABC transporter, permease
tr|Q2G074 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HHT7 Staphylococcus aureus (strain COL) TrEMBL   Iron compound ABC transporter, permease protein
tr|Q6GB97 Staphylococcus aureus (strain MSSA476) TrEMBL   FecCD transport family protein
tr|Q7A1H6 Staphylococcus aureus (strain MW2) TrEMBL   MW0695 protein
tr|Q7A6T0 Staphylococcus aureus (strain N315) TrEMBL   SA0688 protein
tr|Q99VP1 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Ferrichrome ABC transporter permease


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
36 fig|93061.5.peg.674 Iron compound ABC uptake transporter permease protein
46 fig|93061.5.peg.675 Iron compound ABC uptake transporter ATP-binding protein
40 fig|93061.5.peg.676 Iron compound ABC uptake transporter substrate-binding protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search