The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.640: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Hemolysins and related proteins containing CBS domains
Translate Function Assignments



Context on contig NC_007795 from base 690245 to 702165 (11921 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
636 690245 691006 762 +           Transcriptional repressor of the fructose operon, DeoR family locus|SAOUHSC_00706, protein_id|YP_499265.1, gi|88194471, geneID|3919333
637 691003 691923 921 + -4         1-phosphofructokinase (EC 2.7.1.56) locus|SAOUHSC_00707, protein_id|YP_499266.1, gi|88194472, geneID|3919334
638 691929 693887 1959 + 5         PTS system, fructose-specific IIA component / PTS system, fructose-specific IIB component (EC 2.7.1.69) / PTS system, fructose-specific IIC component locus|SAOUHSC_00708, protein_id|YP_499267.1, gi|88194473, geneID|3919335
639 694195 695376 1182 + 307     3: 2 3 6   N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25) locus|SAOUHSC_00710, protein_id|YP_499269.1, gi|88194475, geneID|3919337
640 695621 696946 1326 + 244         Hemolysins and related proteins containing CBS domains locus|SAOUHSC_00711, protein_id|YP_499270.1, gi|88194476, geneID|3919338
641 697168 698007 840 + 221     2: 5 1   Oxidoreductase of aldo/keto reductase family, subgroup 1 locus|SAOUHSC_00712, protein_id|YP_499271.1, gi|88194477, geneID|3919339
642 698139 699122 984 + 131         CsbB stress response protein locus|SAOUHSC_00713, protein_id|YP_499272.1, gi|88194478, geneID|3919340
643 700249 699194 1056 - 71     1: 4   Two component system histidine kinase (EC 2.7.3.-) locus|SAOUHSC_00714, protein_id|YP_499273.1, gi|88194479, geneID|3919341
644 700917 700249 669 - -1         Response regulator SaeR (Staphylococcus exoprotein expression protein R) locus|SAOUHSC_00715, protein_id|YP_499274.1, gi|88194480, geneID|3919342
645 701383 700910 474 - -8         FIG01108426: hypothetical protein locus|SAOUHSC_00716, protein_id|YP_499275.1, gi|88194481, geneID|3919343
646 702165 701725 441 - 341         FIG01107853: hypothetical protein locus|SAOUHSC_00717, protein_id|YP_499276.1, gi|88194482, geneID|3919344

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.640 Hemolysins and related proteins containing CBS domains
MIIFILLIALTTVFVGSEFALVKIRATRIEQLADEGNKPAKIVKKMIANLDYYLSACQLG
ITVTSLGLGWLGEPTFEKLLHPIFEAINLPTALTTTISFAVSFIIVTYLHVVLGELAPKS
IAIQHTEKLALVYARPLFYFGNIMKPLIWLMNGSARVIIRMFGVNPDAQTDAMSEEEIKI
IINNSYNGGEINQTELAYMQNIFSFDERHAKDIMVPRTQMITLNEPFNVDELLETIKEHQ
FTRYPITDDGDKDHIKGFINVKEFLTEYASGKTIKIANYIHELPMISETTRISDALIRMQ
REHVHMSLIIDEYGGTAGILTMEDILEEIVGEIRDEFDDDEVNDIVKIDNKTFQVNGRVL
LDDLTEEFGIEFDDSEDIDTIGGWLQSRNTNLQKDDYVDTTYDRWVVSEIDNHQIIWVIL
NYEFNEARPTIGQSDEDEKSE

MD5 = 1e6775100ab8bf2c5d917c0342e8dc74


  DNA Sequence

>fig|93061.5.peg.640 Hemolysins and related proteins containing CBS domains
ttgattatatttattctattaattgcattaaccactgtatttgttggttcagaatttgca
ttagtaaaaattagagcaacaagaattgaacagctagcagatgaaggaaataaacctgct
aaaatagtaaaaaagatgattgctaatctagattattatctttctgcttgtcagttaggt
ataacagtaacatctttagggttaggttggcttggtgaaccaacgtttgaaaagctatta
cacccaatatttgaagcaatcaatttaccaactgcattaacgacgacgatttcgtttgca
gtgtcatttataatcgttacgtatttgcatgtagtacttggtgaattagcgcctaaatct
atagctattcaacatactgaaaagcttgctttagtatatgcaagaccattgttctatttc
ggtaacattatgaaaccattgatttggctgatgaatggttctgcacgtgttattattaga
atgtttggtgtaaatcctgatgcccaaactgatgcaatgtcagaagaagaaatcaaaatt
attattaacaatagttataatggtggagaaatcaaccaaactgaattggcatatatgcaa
aatatcttttcattcgatgaaagacatgcaaaagatataatggtacctagaactcaaatg
attacactaaatgaaccttttaatgtagacgaattactagaaacaataaaagaacatcaa
tttacgcgttatccaattactgatgatggtgataaagaccacattaaaggatttattaac
gtcaaagaatttttaactgaatacgcttctggaaaaacgattaaaatagcaaactatata
catgagttgccaatgatttcagagacaacacgtatcagtgatgcattaattagaatgcaa
cgtgaacatgtacatatgagtcttattatagatgaatatggtggaacggcaggtatttta
acgatggaagatattttagaagaaatcgttggagaaattcgtgatgaatttgatgatgat
gaagtgaatgatatcgttaaaattgataataagacattccaagtaaatggcagagtacta
ttggatgatttaactgaagagttcggtatagaatttgatgactctgaggatattgatacg
ataggtggatggttacaatctcgtaataccaatttacaaaaagatgattacgtggataca
acttatgatcgctgggttgtttcagaaatcgataaccaccaaattatttgggtgatatta
aactatgaatttaatgaagcgagacctactatcggacagtctgatgaagatgaaaaatca
gaatag


  DNA with Flanking Sequence

>fig|93061.5.peg.640 Hemolysins and related proteins containing CBS domains
agcacgtcttgcaaatggtgcgcttgctggtagtattttaaaaatgaatcatgggttacg
taacttaatatcatttacaggtgatacattagatcatttatggcgagtaacaagtttaaa
tcaagccattgcattaggtatcgatgatagaaaaggtagtattaaagtaaataaggatgc
agatcttgttattctagatgatgatatgaatgtaaaatctacaataaaacaaggcaaggt
tcacacatttagctaataaataatcataattaaatgtatgcaatagatttaatctgttaa
cataagcactttatattatgataaaatagaagcaataacatttttttctgggggtgtcta
aatgggaaggcgataacatgtagttgtaatttaagtcatagtgataaatttgaatgcgtg
ttacccatgagtgacacatataacatggaggtgaatccctagaaatagggaattaattgg
aaacttcgaccataattagtttgattatatttattctattaattgcattaaccactgtat
ttgttggttcagaatttgcattagtaaaaattagagcaacaagaattgaacagctagcag
atgaaggaaataaacctgctaaaatagtaaaaaagatgattgctaatctagattattatc
tttctgcttgtcagttaggtataacagtaacatctttagggttaggttggcttggtgaac
caacgtttgaaaagctattacacccaatatttgaagcaatcaatttaccaactgcattaa
cgacgacgatttcgtttgcagtgtcatttataatcgttacgtatttgcatgtagtacttg
gtgaattagcgcctaaatctatagctattcaacatactgaaaagcttgctttagtatatg
caagaccattgttctatttcggtaacattatgaaaccattgatttggctgatgaatggtt
ctgcacgtgttattattagaatgtttggtgtaaatcctgatgcccaaactgatgcaatgt
cagaagaagaaatcaaaattattattaacaatagttataatggtggagaaatcaaccaaa
ctgaattggcatatatgcaaaatatcttttcattcgatgaaagacatgcaaaagatataa
tggtacctagaactcaaatgattacactaaatgaaccttttaatgtagacgaattactag
aaacaataaaagaacatcaatttacgcgttatccaattactgatgatggtgataaagacc
acattaaaggatttattaacgtcaaagaatttttaactgaatacgcttctggaaaaacga
ttaaaatagcaaactatatacatgagttgccaatgatttcagagacaacacgtatcagtg
atgcattaattagaatgcaacgtgaacatgtacatatgagtcttattatagatgaatatg
gtggaacggcaggtattttaacgatggaagatattttagaagaaatcgttggagaaattc
gtgatgaatttgatgatgatgaagtgaatgatatcgttaaaattgataataagacattcc
aagtaaatggcagagtactattggatgatttaactgaagagttcggtatagaatttgatg
actctgaggatattgatacgataggtggatggttacaatctcgtaataccaatttacaaa
aagatgattacgtggatacaacttatgatcgctgggttgtttcagaaatcgataaccacc
aaattatttgggtgatattaaactatgaatttaatgaagcgagacctactatcggacagt
ctgatgaagatgaaaaatcagaatagatattaatatataaaccaactaagaatgatttaa
ttcatttttggttggttatttttttgactaaaattaatgaaaagtgaaaatagtattgga
actcaatatctttaatgatttaatgaataatttttattgaaagcgataattcgtattaat
tgagtttgttgaaaaatttagggtaatgtaaagatataaaagatacatagattggagaga
tataaagatgttgaatgagatacaaatattaaataatggatacccgatgccttcagttgg
gttaggtgtttataaaatctctgacgaagatatgactaaagttgtaaatgctgcaattga
cgcaggctatagagcgtttgatacagcatacttttatgataatgaggcttcactaggacg
agcattaaaggataatggcgtcgatagagaagatttgtttataacaacgaagttatggaa
tgactatcaaggttatgagaaaacattcgaatatttcaacaaatcg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|158878.14.peg.711 Staphylococcus aureus subsp. aureus Mu50 FIG   Hemolysins and related proteins containing CBS domains
fig|158879.11.peg.688 Staphylococcus aureus subsp. aureus N315 FIG   Hemolysins and related proteins containing CBS domains
fig|196620.5.peg.699 Staphylococcus aureus subsp. aureus MW2 FIG   Hemolysins and related proteins containing CBS domains
fig|359786.13.peg.780 Staphylococcus aureus subsp. aureus JH9 FIG   Hemolysins and related proteins containing CBS domains
fig|450394.6.peg.1264 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Hemolysins and related proteins containing CBS domains
fig|451515.3.peg.762 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Hemolysins and related proteins containing CBS domains
fig|455227.3.peg.307 Staphylococcus aureus D30 FIG   Hemolysins and related proteins containing CBS domains
fig|505321.3.peg.818 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Hemolysins and related proteins containing CBS domains
fig|546342.3.peg.2356 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Hemolysins and related proteins containing CBS domains
fig|546343.3.peg.932 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Hemolysins and related proteins containing CBS domains
fig|548474.3.peg.1521 Staphylococcus aureus subsp. aureus TCH130 FIG   Hemolysins and related proteins containing CBS domains
fig|548475.3.peg.1002 Staphylococcus aureus subsp. aureus TCH70 FIG   Hemolysins and related proteins containing CBS domains
fig|553565.3.peg.783 Staphylococcus aureus A5937 FIG   Hemolysins and related proteins containing CBS domains
fig|553567.3.peg.2408 Staphylococcus aureus A5948 FIG   Hemolysins and related proteins containing CBS domains
fig|553568.3.peg.1980 Staphylococcus aureus A6224 FIG   Hemolysins and related proteins containing CBS domains
fig|553571.3.peg.880 Staphylococcus aureus A6300 FIG   Hemolysins and related proteins containing CBS domains
fig|553573.3.peg.399 Staphylococcus aureus A8115 FIG   Hemolysins and related proteins containing CBS domains
fig|553577.3.peg.1217 Staphylococcus aureus A8796 FIG   Hemolysins and related proteins containing CBS domains
fig|553580.3.peg.1562 Staphylococcus aureus A8819 FIG   Hemolysins and related proteins containing CBS domains
fig|553581.3.peg.524 Staphylococcus aureus A9299 FIG   Hemolysins and related proteins containing CBS domains
fig|553588.3.peg.1924 Staphylococcus aureus A9719 FIG   Hemolysins and related proteins containing CBS domains
fig|553592.3.peg.2634 Staphylococcus aureus A9763 FIG   Hemolysins and related proteins containing CBS domains
fig|553601.3.peg.283 Staphylococcus aureus A10102 FIG   Hemolysins and related proteins containing CBS domains
fig|585891.3.peg.710 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Hemolysins and related proteins containing CBS domains
fig|681288.4.peg.657 Staphylococcus aureus subsp. aureus ED98 FIG   Hemolysins and related proteins containing CBS domains
fig|703339.3.peg.686 Staphylococcus aureus 04-02981 FIG   Hemolysins and related proteins containing CBS domains
fig|762962.3.peg.1279 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Hemolysins and related proteins containing CBS domains
gb|EES55432.1 Staphylococcus aureus subsp. aureus TCH70     TlyC family hemolysin
gb|EES93795.1 Staphylococcus aureus subsp. aureus USA300_TCH959     TlyC family hemolysin
gi|221139305 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   CBS domain-containing protein
gi|251802775 Staphylococcus aureus subsp. aureus TCH70 NCBI   TlyC family hemolysin
gi|251813669 Staphylococcus aureus subsp. aureus TCH70 NCBI   TlyC family hemolysin
gi|253315341 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   putative hemolysin
gi|253725066 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   TlyC family hemolysin
gi|253731325 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   TlyC family hemolysin
ref|ZP_03564105.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   CBS domain-containing protein
ref|ZP_04828142.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   TlyC family hemolysin
ref|ZP_04838554.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   putative hemolysin
ref|ZP_04865490.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   TlyC family hemolysin
tr|C5N3E8 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   TlyC family hemolysin
tr|C5QH76 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   TlyC family hemolysin


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search