The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.607: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: FIG018171: hypothetical protein of Cupin superfamily
Translate Function Assignments



Context on contig NC_007795 from base 660690 to 671308 (10619 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
603 660690 661334 645 +           FIG01108329: hypothetical protein locus|SAOUHSC_00672, protein_id|YP_499231.1, gi|88194437, geneID|3919435
604 662031 664181 2151 + 696     1: 1   Transcriptional regulator of biofilm formation (AraC/XylS family) locus|SAOUHSC_00673, protein_id|YP_499232.1, gi|88194438, geneID|3919436
605 664261 664686 426 + 79         FIG01108210: hypothetical protein locus|SAOUHSC_00674, protein_id|YP_499233.1, gi|88194439, geneID|3919437
606 664876 665592 717 + 189         Transcriptional regulatory protein YeeN locus|SAOUHSC_00675, protein_id|YP_499234.1, gi|88194440, geneID|3919438
607 665592 666065 474 + -1         FIG018171: hypothetical protein of Cupin superfamily locus|SAOUHSC_00676, protein_id|YP_499235.1, gi|88194441, geneID|3919439
608 666157 666273 117 + 91         FIG01109083: hypothetical protein locus|SAOUHSC_00677, protein_id|YP_499236.1, gi|88194442, geneID|3919440
609 666418 667062 645 + 144         FIG01107967: hypothetical protein locus|SAOUHSC_00678, protein_id|YP_499237.1, gi|88194443, geneID|3919441
610 667178 668044 867 + 115         LysR family transcriptional regulator locus|SAOUHSC_00679, protein_id|YP_499238.1, gi|88194444, geneID|3919442
611 668245 669465 1221 + 200         Sugar efflux transpoter locus|SAOUHSC_00681, protein_id|YP_499240.1, gi|88194446, geneID|3919444
612 669462 669950 489 + -4         Putative membrane protein locus|SAOUHSC_00682, protein_id|YP_499241.1, gi|88194447, geneID|3919445
613 670738 670049 690 - 98         FIG01107852: hypothetical protein locus|SAOUHSC_00683, protein_id|YP_499242.1, gi|88194448, geneID|3919446
614 670991 671308 318 + 252         FIG01108170: hypothetical protein locus|SAOUHSC_00684, protein_id|YP_499243.1, gi|88194449, geneID|3919447

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.607 FIG018171: hypothetical protein of Cupin superfamily
MKSAEQWIDELQLESHPEGGFYRETIREVLKDGRRAPFSSIYFLLTDDNISHFHRIDADE
VWYYHAGDSLTIHMINPDGEYTTATLGTDIQNGDVLQYVVPKGTIFASSIEISNTFSLVG
CMCQPAFEFKQFELFKQSELITQYPHLKSVIEKYALK

MD5 = 67aec4738cc81b02a52e6d875624e6b9


  DNA Sequence

>fig|93061.5.peg.607 FIG018171: hypothetical protein of Cupin superfamily
atgaaatcagcagaacaatggattgatgaattgcaacttgaatcacatcctgaaggtggt
ttctatagagagacaattcgagaagtattgaaagatggacgcagagcgccgtttagtagt
atttattttttacttacagatgacaatatttcgcattttcatcgaattgatgctgatgaa
gtatggtactatcatgctggcgattctctaacaattcatatgataaatccggatggggaa
tatacgactgcaacattgggtactgatatccaaaatggagatgtattgcaatatgtagtg
cctaaaggaacaatttttgcttcttcaatcgaaatatcaaatacttttagtttagtaggt
tgtatgtgtcaaccggcatttgagtttaagcagtttgaattgtttaagcaatctgaatta
attacgcaatatccgcatcttaaatcagtaatcgaaaaatatgctttaaaataa


  DNA with Flanking Sequence

>fig|93061.5.peg.607 FIG018171: hypothetical protein of Cupin superfamily
ggtgctggagacgaaaactttgatcacctaagatatgaaggatttggcccaagcggatca
atgctaattgttgatgcgttaacaaataatgtaaatcgtactgcctctgatgtgcgagct
gcttttggtaaaaacggcggtaatatgggtgtatctggatcagttgcttatatgtttgat
catgtggcaacatttggtattgaaggaaagtctgttgacgaaatacttgaaacattaatg
gaacaagatgtagatgtaaatgatgtgattgacgataatggattgacaatagtctatgct
gaaccagatcaatttgcagtcgttcaagatgcgcttcgtgcagcaggtgttgaagaattt
aaagttgctgaatttgaaatgttacctcaaacagatattgaactttctgaagcggaccaa
gtaacatttgaaaaattaatcgatgcattagaagatttagaagatgtacaaaacgtattc
cataatgtggatttgaaataatgaaatcagcagaacaatggattgatgaattgcaacttg
aatcacatcctgaaggtggtttctatagagagacaattcgagaagtattgaaagatggac
gcagagcgccgtttagtagtatttattttttacttacagatgacaatatttcgcattttc
atcgaattgatgctgatgaagtatggtactatcatgctggcgattctctaacaattcata
tgataaatccggatggggaatatacgactgcaacattgggtactgatatccaaaatggag
atgtattgcaatatgtagtgcctaaaggaacaatttttgcttcttcaatcgaaatatcaa
atacttttagtttagtaggttgtatgtgtcaaccggcatttgagtttaagcagtttgaat
tgtttaagcaatctgaattaattacgcaatatccgcatcttaaatcagtaatcgaaaaat
atgctttaaaataaaagtgatcaatgaagtggtttgaaggttgttaataaacctttgagt
cacttcatttttatatgtattcttgattgaatcagaatagatttgatgcttcagctgttt
ttaatgaaaatagcattaaatgattttgaaaacgataagagtgtgttatttatatttttg
aaaaatcacttttatgaagaaatgtgtgtactatctaattaatattgtctattttaagta
aattgaagcgagttgtagtaaaataataataaatattttcatatgattaacaaaaactat
aaaactgtatcatgacatgacatcatttatgtagttttatataataatgacaaggagttg
gtgactgtgaaagtaaagtatatagataaacgtcactggcgtcgcctaattgatagggaa
tacacagaggtaaaagttaataataataggtttaagggtattataggcttagtcacgatg
aaaaaggttcgtgatcctttagaggtgacggtag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA0608 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
cmr|SACOL0728 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_0656 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAF66911.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.1291 Staphylococcus aureus subsp. aureus USA300 FIG   FIG018171: hypothetical protein of Cupin superfamily
fig|426430.6.peg.629 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG018171: hypothetical protein of Cupin superfamily
fig|426430.8.peg.691 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG018171: hypothetical protein of Cupin superfamily
fig|451515.3.peg.730 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   FIG018171: hypothetical protein of Cupin superfamily
fig|451516.9.peg.734 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG018171: hypothetical protein of Cupin superfamily
fig|452948.4.peg.774 Staphylococcus aureus 930918-3 FIG   FIG018171: hypothetical protein of Cupin superfamily
fig|455227.3.peg.339 Staphylococcus aureus D30 FIG   FIG018171: hypothetical protein of Cupin superfamily
fig|546342.3.peg.2324 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   FIG018171: hypothetical protein of Cupin superfamily
fig|546343.3.peg.900 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   FIG018171: hypothetical protein of Cupin superfamily
fig|548474.3.peg.1556 Staphylococcus aureus subsp. aureus TCH130 FIG   FIG018171: hypothetical protein of Cupin superfamily
fig|553567.3.peg.2375 Staphylococcus aureus A5948 FIG   FIG018171: hypothetical protein of Cupin superfamily
fig|553594.3.peg.972 Staphylococcus aureus A9765 FIG   FIG018171: hypothetical protein of Cupin superfamily
fig|644279.4.peg.754 Staphylococcus aureus subsp. aureus 132 FIG   FIG018171: hypothetical protein of Cupin superfamily
fig|93061.3.peg.650 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG018171: hypothetical protein of Cupin superfamily
fig|93062.19.peg.708 Staphylococcus aureus subsp. aureus COL FIG   FIG018171: hypothetical protein of Cupin superfamily
fig|93062.4.peg.240 Staphylococcus aureus subsp. aureus COL FIG   FIG018171: hypothetical protein of Cupin superfamily
gb|AAW37791.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD21557.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD29809.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX28712.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_0691
gb|EES97798.1 Staphylococcus aureus subsp. aureus TCH130     protein of hypothetical function DUF985
gb|EEV82243.1 Staphylococcus aureus A5948     conserved hypothetical protein
gi|150373651 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151220851 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0639
gi|160367741 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0691
gi|161508932 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0691
gi|221139273 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_11615
gi|221140886 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_04508
gi|253729069 Staphylococcus aureus subsp. aureus TCH130 NCBI   protein of hypothetical function DUF985
gi|253732889 Staphylococcus aureus subsp. aureus TCH130 NCBI   protein of hypothetical function DUF985
gi|257859389 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258452878 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|57285697 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57651511 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0728
gi|87127043 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87161069 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0656
gi|87201999 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194441 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00676
img|637151505 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637887310 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637893325 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640795015 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641308658 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641773251 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_0656 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL0728 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0639 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_00676 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_0691 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001331673.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0639
ref|YP_001574591.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_0691
ref|YP_185609.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0728
ref|YP_493359.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0656
ref|YP_499235.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00676
ref|ZP_03564073.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_11615
ref|ZP_03565379.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_04508
ref|ZP_04867054.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   protein of hypothetical function DUF985
ref|ZP_05700872.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QEX9 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z191 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|C5PYT5 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Protein of hypothetical function DUF985
tr|Q2FIW9 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2G0C9 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HHZ8 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search