The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.535: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: repetative hypothetical protein , fig|282458.1.peg.574 homolog
Translate Function Assignments



Context on contig NC_007795 from base 586839 to 599220 (12382 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
527 586839 587465 627 +           repetative hypothetical protein , fig|282458.1.peg.574 homolog locus|SAOUHSC_00585, protein_id|YP_499152.1, gi|88194359, geneID|3920509
528 587591 588232 642 + 125         repetative hypothetical protein , fig|282458.1.peg.574 homolog locus|SAOUHSC_00586, protein_id|YP_499153.1, gi|88194360, geneID|3920510
529 588320 588937 618 + 87         repetative hypothetical protein , fig|282458.1.peg.574 homolog locus|SAOUHSC_00587, protein_id|YP_499154.1, gi|88194361, geneID|3920511
530 589012 589641 630 + 74         repetative hypothetical protein , fig|282458.1.peg.574 homolog locus|SAOUHSC_00588, protein_id|YP_499155.1, gi|88194362, geneID|3920512
531 589837 590430 594 + 195         repetative hypothetical protein , fig|282458.1.peg.574 homolog locus|SAOUHSC_00591, protein_id|YP_499157.1, gi|88194364, geneID|3920514
532 590598 591230 633 + 167         repetative hypothetical protein , fig|282458.1.peg.574 homolog locus|SAOUHSC_00592, protein_id|YP_499158.1, gi|88194365, geneID|3920515
533 591277 591744 468 + 46         repetative hypothetical protein , fig|282458.1.peg.574 homolog locus|SAOUHSC_00593, protein_id|YP_499159.1, gi|88194366, geneID|3920516
534 591777 591905 129 + 32         repetative hypothetical protein , fig|282458.1.peg.574 homolog locus|SAOUHSC_00595, protein_id|YP_499160.1, gi|88194367, geneID|3920517
535 592358 592987 630 + 452         repetative hypothetical protein , fig|282458.1.peg.574 homolog locus|SAOUHSC_00596, protein_id|YP_499161.1, gi|88194368, geneID|3920518
536 593111 593752 642 + 123         repetative hypothetical protein , fig|282458.1.peg.574 homolog locus|SAOUHSC_00598, protein_id|YP_499162.1, gi|88194369, geneID|3920519
537 593861 594424 564 + 108         repetative hypothetical protein , fig|282458.1.peg.574 homolog locus|SAOUHSC_00599, protein_id|YP_499163.1, gi|88194370, geneID|3920520
538 594390 594635 246 + -35         FIG01108436: hypothetical protein locus|SAOUHSC_00600, protein_id|YP_499164.1, gi|88194371, geneID|3920521
539 594659 595285 627 + 23         repetative hypothetical protein , fig|282458.1.peg.574 homolog locus|SAOUHSC_00602, protein_id|YP_499165.1, gi|88194372, geneID|3918921
540 595555 596493 939 + 269         Oxidoreductase ion channel locus|SAOUHSC_00603, protein_id|YP_499166.1, gi|88194373, geneID|3918922
541 596704 597240 537 + 210         hypothetical fig|282458.1.peg.578 homolog locus|SAOUHSC_00604, protein_id|YP_499167.1, gi|88194374, geneID|3918923
542 597409 597885 477 + 168         hypothetical fig|282458.1.peg.579 homolog locus|SAOUHSC_00605, protein_id|YP_499168.1, gi|88194375, geneID|3918924
543 597925 599220 1296 + 39     2: 2 1   dNTP triphosphohydrolase, putative locus|SAOUHSC_00606, protein_id|YP_499169.1, gi|88194376, geneID|3918925

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.535 repetative hypothetical protein , fig|282458.1.peg.574 homolog
MLLCDVRVIYKNPKYKVIQHNGEYLLVDLVSTWFVYFFPFINWFIPKKYAIISEEEFENL
NVVKPNKNNVFWSVIGSSVLFGVTLRKYIHVFDVQLDKLVVMILCALALICVIVFYFNLN
RKLKLKVFDTNIEKNKRVILIPTFKLGCFLVFGYIFAGSFSIFSLIALMTIEPQNIIIFI
YWIMMTMLFFLLNMTSIGNEKVRVIMKNN

MD5 = 2644d13ab362e48f46d22587db09deee


  DNA Sequence

>fig|93061.5.peg.535 repetative hypothetical protein , fig|282458.1.peg.574 homolog
atgttgctttgcgatgtcagagtcatttataaaaatccgaaatacaaagtcattcaacat
aacggtgaatacttattagtcgatttagtaagcacttggttcgtgtacttttttcctttc
attaattggttcattccaaaaaagtacgcgataattagcgaagaagaatttgaaaattta
aatgttgttaaaccaaataaaaataatgttttctggtcagttataggaagttcggttttg
tttggagttactttaaggaaatacatacatgtttttgatgttcaattagataagctagtt
gtaatgatattgtgtgctctcgctttaatttgtgttatagttttttattttaacttaaat
agaaagcttaagttaaaagtgtttgatacaaatattgaaaaaaataagagagttatatta
ataccaacgtttaaacttggctgttttttagttttcggatatattttcgctggaagtttt
tcaatattttcattaattgcccttatgacaatcgaacctcaaaatataataatatttatt
tattggattatgatgacaatgcttttctttttgttaaatatgacttcgataggtaatgaa
aaagttcgcgttataatgaaaaataattga


  DNA with Flanking Sequence

>fig|93061.5.peg.535 repetative hypothetical protein , fig|282458.1.peg.574 homolog
tcgataggtaataaaaatgttcatgttattttaagaataaacgagtagtaaaaatgatcg
aaattggtagtatcgcatatttaaacggtggttcaaaaaaatataatcatatcttaaatc
aggaaaatagatagtaatgtttgaatataccaagtgaaaatgcccattgtgattgataaa
ggaaaaaactgttttaatttaaaaatgaaatatagagcgtgttattttgtatgatagctc
ttataacattggcgtttttaatccaatagtatggacggttttagctggttttgttgcgga
atctgtttagacaattcttaaaaattggacttttcatactaataaatttggattaagaga
taaaactaattggataagacattaaatagacgctgtttaaaaataccacagaaaaagctg
tagatagtgttggaacgatagttggtgaaggtacaaaaagtattggggatcatttaaaac
taatgaaacgggagtggtaaatgttgctttgcgatgtcagagtcatttataaaaatccga
aatacaaagtcattcaacataacggtgaatacttattagtcgatttagtaagcacttggt
tcgtgtacttttttcctttcattaattggttcattccaaaaaagtacgcgataattagcg
aagaagaatttgaaaatttaaatgttgttaaaccaaataaaaataatgttttctggtcag
ttataggaagttcggttttgtttggagttactttaaggaaatacatacatgtttttgatg
ttcaattagataagctagttgtaatgatattgtgtgctctcgctttaatttgtgttatag
ttttttattttaacttaaatagaaagcttaagttaaaagtgtttgatacaaatattgaaa
aaaataagagagttatattaataccaacgtttaaacttggctgttttttagttttcggat
atattttcgctggaagtttttcaatattttcattaattgcccttatgacaatcgaacctc
aaaatataataatatttatttattggattatgatgacaatgcttttctttttgttaaata
tgacttcgataggtaatgaaaaagttcgcgttataatgaaaaataattgattacatttaa
aatattctaaatgttgtcgacacaatccttttaagacgctagtagaatttaaatgacttc
taatgtatatgaaagtgtatcaatataaaaccaattgaaaagaagtggagacattgcttt
gtgaaactgaaaatattaataagaatcccaaatatagaattatcaaatacaaagatgaat
atttgatgattgatttagtaagtacatggttagcactctttttcccaatgattaattggc
tgattccaaaaaagtacgtcaaaatcagcgaaaaagattttgaaactttaaacattgtga
agacagctaaaatcaattctttttggccagtggcaggaagtacggtcttatttggtgtta
tgttaagaaggtattcccatttatttatcgttaaatatgaatatagtatagtaattttaa
tttgttgcatcataatactaggtatttttctgttttttttatatttaaatcaaaagttaa
agttacaaat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT03SA0620 Staphylococcus aureus MW2     Staphylococcus aureus paralogous family TIGR01218
cmr|NT05SA0536 Staphylococcus aureus NCTC 8325     staphylococcus aureus paralogous family
cmr|NT09SA0574 Staphylococcus aureus subsp. aureus MSSA476     Staphylococcus aureus paralogous family TIGR01218
cmr|SACOL0651 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_0585 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB94424.1 Staphylococcus aureus subsp. aureus MW2     conserved hypothetical protein
dbj|BAF66839.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
emb|CAG42338.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative membrane protein
fig|196620.1.peg.559 Staphylococcus aureus subsp. aureus MW2 FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|196620.5.peg.591 Staphylococcus aureus subsp. aureus MW2 FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|282459.1.peg.557 Staphylococcus aureus subsp. aureus MSSA476 FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|282459.5.peg.588 Staphylococcus aureus subsp. aureus MSSA476 FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|367830.3.peg.770 Staphylococcus aureus subsp. aureus USA300 FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|426430.6.peg.563 Staphylococcus aureus subsp. aureus str. Newman FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|426430.8.peg.617 Staphylococcus aureus subsp. aureus str. Newman FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|451515.3.peg.656 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|451516.9.peg.644 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|452948.4.peg.967 Staphylococcus aureus 930918-3 FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|455227.3.peg.1736 Staphylococcus aureus D30 FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|546342.3.peg.525 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|546343.3.peg.1602 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|548475.3.peg.894 Staphylococcus aureus subsp. aureus TCH70 FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|553567.3.peg.433 Staphylococcus aureus A5948 FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|553590.4.peg.1318 Staphylococcus aureus A9754 FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|553594.3.peg.2215 Staphylococcus aureus A9765 FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|644279.4.peg.682 Staphylococcus aureus subsp. aureus 132 FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|762962.3.peg.86 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|93061.3.peg.576 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|93062.19.peg.636 Staphylococcus aureus subsp. aureus COL FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
fig|93062.4.peg.144 Staphylococcus aureus subsp. aureus COL FIG   repetative hypothetical protein , fig|282458.1.peg.574 homolog
gb|AAW36342.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD20997.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD29736.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX28626.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_0601
gb|EES55585.1 Staphylococcus aureus subsp. aureus TCH70     conserved hypothetical protein
gb|EEV84171.1 Staphylococcus aureus A5948     conserved hypothetical protein
gi|150373579 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151220779 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0567
gi|160367655 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0601
gi|161508846 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0601
gi|21203725 Staphylococcus aureus subsp. aureus MW2 NCBI   conserved hypothetical protein
gi|21282288 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW0559
gi|221137542 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_02668
gi|221141566 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_07990
gi|251802928 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|251813560 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|257861362 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258450942 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|49243912 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative membrane protein
gi|49485469 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS0564
gi|57284248 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57650062 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0651
gi|87126483 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87160509 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0585
gi|87201926 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194368 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00596
img|637151432 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637156790 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637298319 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637887239 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637893251 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640794943 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641308572 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641772246 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_0585 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL0651 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0567 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sam:MW0559 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_00596 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS0564   KEGG   hypothetical protein
kegg|sax:USA300HOU_0601 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_645376.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW0559
ref|YP_001331601.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0567
ref|YP_001574505.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_0601
ref|YP_042690.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS0564
ref|YP_185536.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0651
ref|YP_493288.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0585
ref|YP_499161.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00596
ref|ZP_03562348.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_02668
ref|ZP_03566059.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_07990
ref|ZP_04828033.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   conserved hypothetical protein
ref|ZP_05698994.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QEQ7 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z105 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|C5QGW7 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Putative uncharacterized protein
tr|Q2FJ40 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2G0H1 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HI71 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6GBN3 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative membrane protein
tr|Q8NXU9 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW0559


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search