The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.403: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Acetyltransferase SERP0113, GNAT family
Translate Function Assignments



Context on contig NC_007795 from base 439581 to 450374 (10794 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
rna.3 439581 439673 93 +           tRNA-Ser-TGA  
400 440144 441571 1428 + 470         PTS system, trehalose-specific IIB component (EC 2.7.1.69) / PTS system, trehalose-specific IIC component (EC 2.7.1.69) locus|SAOUHSC_00437, protein_id|YP_499020.1, gi|88194228, geneID|3919109
401 441635 443275 1641 + 63         Trehalose-6-phosphate hydrolase (EC 3.2.1.93) locus|SAOUHSC_00438, protein_id|YP_499021.1, gi|88194229, geneID|3919110
402 443300 444028 729 + 24         Trehalose operon transcriptional repressor TreR, HutC family locus|SAOUHSC_00439, protein_id|YP_499022.1, gi|88194230, geneID|3919111
403 444667 445191 525 + 638         Acetyltransferase SERP0113, GNAT family locus|SAOUHSC_00441, protein_id|YP_499024.1, gi|88194232, geneID|3919113
404 445260 446957 1698 + 68     2: 1 2   DNA polymerase III subunits gamma and tau (EC 2.7.7.7) locus|SAOUHSC_00442, protein_id|YP_499025.1, gi|88194233, geneID|3919114
405 447047 447364 318 + 89     2: 3 1   Nucleoid-associated protein YaaK locus|SAOUHSC_00444, protein_id|YP_499026.1, gi|88194234, geneID|3919115
406 447371 447967 597 + 6     3: 3 1 2   Recombination protein RecR gene_name|recR, locus|SAOUHSC_00445, protein_id|YP_499027.1, gi|88194235, geneID|3919116
rna.4 448819 450374 1556 + 851     2: 4 5   Small Subunit Ribosomal RNA; ssuRNA; SSU rRNA  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.403 Acetyltransferase SERP0113, GNAT family
MQIYLSTLTELDYDKSLNSIEESFDDNPETSWQARAKVKHLRKSPCYNFELEVIAKNENN
DVVGHVLLIEVEINSDDKTYYGLAIASLSVHPELRGQKLGRGLVQAVEERAKAQEYSTVV
VDHCFDYFEKLGYQNAAEHDIKLESGDAPLLVKYLWDNLTDAPHGIVKFPEHFY

MD5 = 3ffbdc001d064b9306e0c2d508927214


  DNA Sequence

>fig|93061.5.peg.403 Acetyltransferase SERP0113, GNAT family
atgcaaatatatttaagtactttaacagagttagattatgataaatctttaaatagtatt
gaagaaagttttgatgataatcctgaaacgagttggcaagcacgtgcgaaagtaaaacat
ttaagaaaatctccttgctataattttgaattagaagtaatagcgaaaaatgaaaataac
gatgtcgttggacacgttttattaattgaagtagaaattaatagtgatgataagacgtat
tatggtttggcgattgcctctttatcagttcatcctgaattacgtggacaaaaattaggt
cgtggcttggttcaagcagtagaagagcgtgccaaagcacaagagtatagtacggttgtt
gtagaccattgttttgactactttgaaaagttgggttatcaaaatgctgctgagcatgac
attaaattagaatctggtgatgcaccgttacttgtaaaatatttatgggataatttgacg
gatgcaccacacggaatcgtaaaatttccagaacatttttattaa


  DNA with Flanking Sequence

>fig|93061.5.peg.403 Acetyltransferase SERP0113, GNAT family
gtatttttgcgaagtctgcccaaagcacgtagtgtttgaagatttcggtcctatgcaata
tgaacccatgaaccatgtcaggtcctgacggaagcagcattaagtggatcatcatatgtg
ccgtagggtagccgagatttagctaacgactttggttacgttcgtgaattacgttcgatg
cttaggtgcacggttttttattttttaaatattaaaccgattattaagagttgaaaatat
ataattatagaagctactttcttgaagacaattcagcgtattatacgtggaacatgtttg
tgggaagtagcttttttatatgtgaagtttgattcaagtgaactcgatgtgcagtttgaa
tgatttttgtgtcaatgaaaagtaagaagttataatttgatgataaagaaatgatggtga
aatgagggggagtatcttacaatagaattattaatgagatacgttatgattattgacaat
caaatgcctacggaggacatatgcaaatatatttaagtactttaacagagttagattatg
ataaatctttaaatagtattgaagaaagttttgatgataatcctgaaacgagttggcaag
cacgtgcgaaagtaaaacatttaagaaaatctccttgctataattttgaattagaagtaa
tagcgaaaaatgaaaataacgatgtcgttggacacgttttattaattgaagtagaaatta
atagtgatgataagacgtattatggtttggcgattgcctctttatcagttcatcctgaat
tacgtggacaaaaattaggtcgtggcttggttcaagcagtagaagagcgtgccaaagcac
aagagtatagtacggttgttgtagaccattgttttgactactttgaaaagttgggttatc
aaaatgctgctgagcatgacattaaattagaatctggtgatgcaccgttacttgtaaaat
atttatgggataatttgacggatgcaccacacggaatcgtaaaatttccagaacattttt
attaattgttcaattaagaagtaaaggtattatcatgctataatgagaggtaattgttta
tggaggtgctaacttgaattatcaagccttatatcgtatgtacagaccccaaagtttcga
ggatgtcgtcggacaagaacatgtcacgaagacattgcgcaatgcgatttcgaaagaaaa
acagtcgcatgcttatatttttagtggtccgagaggtacggggaaaacgagtattgccaa
agtgtttgctaaagcaatcaactgtctaaatagcactgatggagaaccttgtaatgaatg
tcatatttgtaaaggcattacgcaggggactaattcagatgtgatagaaattgatgctgc
tagtaataatggcgttgatgaaataagaaatattagagacaaagttaaatatgcaccaag
tgaatcgaaatataaagtttatattatagatgaggtgcacatgctaacaacaggtgcttt
taatgcccttttaaagacgttagaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0008080       F:N-acetyltransferase activity
GO:0008152       P:metabolic process
cmr|NT01SA0473 Staphylococcus aureus N315     acetyltransferase, GNAT family
cmr|NT02SA0468 Staphylococcus aureus Mu50     acetyltransferase, GNAT family family
cmr|NT05SA0393 Staphylococcus aureus NCTC 8325     acetyltransferase family protein
cmr|SAUSA300_0451 Staphylococcus aureus subsp. aureus USA300-FPR3757     acetyltransferase, GNAT family
dbj|BAB41665.1 Staphylococcus aureus subsp. aureus N315     conserved hypothetical protein
dbj|BAB56639.1 Staphylococcus aureus subsp. aureus Mu50     conserved hypothetical protein
dbj|BAF66713.1 Staphylococcus aureus subsp. aureus str. Newman     acetyltransferase, GNAT family protein
dbj|BAF77357.1 Staphylococcus aureus subsp. aureus Mu3     conserved hypothetical protein
fig|158878.1.peg.477 Staphylococcus aureus subsp. aureus Mu50 FIG   Acetyltransferase SERP0113, GNAT family
fig|158878.14.peg.480 Staphylococcus aureus subsp. aureus Mu50 FIG   Acetyltransferase SERP0113, GNAT family
fig|158879.1.peg.448 Staphylococcus aureus subsp. aureus N315 FIG   Acetyltransferase SERP0113, GNAT family
fig|158879.11.peg.460 Staphylococcus aureus subsp. aureus N315 FIG   Acetyltransferase SERP0113, GNAT family
fig|359786.13.peg.550 Staphylococcus aureus subsp. aureus JH9 FIG   Acetyltransferase SERP0113, GNAT family
fig|359786.3.peg.1427 Staphylococcus aureus subsp. aureus JH9 FIG   Acetyltransferase SERP0113, GNAT family
fig|359787.11.peg.541 Staphylococcus aureus subsp. aureus JH1 FIG   Acetyltransferase SERP0113, GNAT family
fig|359787.3.peg.441 Staphylococcus aureus subsp. aureus JH1 FIG   Acetyltransferase SERP0113, GNAT family
fig|367830.3.peg.96 Staphylococcus aureus subsp. aureus USA300 FIG   Acetyltransferase SERP0113, GNAT family
fig|418127.4.peg.443 Staphylococcus aureus subsp. aureus Mu3 FIG   Acetyltransferase SERP0113, GNAT family
fig|418127.6.peg.479 Staphylococcus aureus subsp. aureus Mu3 FIG   Acetyltransferase SERP0113, GNAT family
fig|426430.6.peg.441 Staphylococcus aureus subsp. aureus str. Newman FIG   Acetyltransferase SERP0113, GNAT family
fig|426430.8.peg.484 Staphylococcus aureus subsp. aureus str. Newman FIG   Acetyltransferase SERP0113, GNAT family
fig|450394.6.peg.2258 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Acetyltransferase SERP0113, GNAT family
fig|451515.3.peg.522 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Acetyltransferase SERP0113, GNAT family
fig|451516.9.peg.512 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Acetyltransferase SERP0113, GNAT family
fig|452948.4.peg.1054 Staphylococcus aureus 930918-3 FIG   Acetyltransferase SERP0113, GNAT family
fig|455227.3.peg.1790 Staphylococcus aureus D30 FIG   Acetyltransferase SERP0113, GNAT family
fig|546342.3.peg.2165 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Acetyltransferase SERP0113, GNAT family
fig|546343.3.peg.2614 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Acetyltransferase SERP0113, GNAT family
fig|553565.3.peg.2776 Staphylococcus aureus A5937 FIG   Acetyltransferase SERP0113, GNAT family
fig|553567.3.peg.1993 Staphylococcus aureus A5948 FIG   Acetyltransferase SERP0113, GNAT family
fig|553568.3.peg.494 Staphylococcus aureus A6224 FIG   Acetyltransferase SERP0113, GNAT family
fig|553571.3.peg.673 Staphylococcus aureus A6300 FIG   Acetyltransferase SERP0113, GNAT family
fig|553573.3.peg.2254 Staphylococcus aureus A8115 FIG   Acetyltransferase SERP0113, GNAT family
fig|553574.3.peg.963 Staphylococcus aureus A8117 FIG   Acetyltransferase SERP0113, GNAT family
fig|553577.3.peg.1700 Staphylococcus aureus A8796 FIG   Acetyltransferase SERP0113, GNAT family
fig|553580.3.peg.867 Staphylococcus aureus A8819 FIG   Acetyltransferase SERP0113, GNAT family
fig|553581.3.peg.1237 Staphylococcus aureus A9299 FIG   Acetyltransferase SERP0113, GNAT family
fig|553588.3.peg.1770 Staphylococcus aureus A9719 FIG   Acetyltransferase SERP0113, GNAT family
fig|553590.4.peg.2704 Staphylococcus aureus A9754 FIG   Acetyltransferase SERP0113, GNAT family
fig|553592.3.peg.1743 Staphylococcus aureus A9763 FIG   Acetyltransferase SERP0113, GNAT family
fig|553594.3.peg.1923 Staphylococcus aureus A9765 FIG   Acetyltransferase SERP0113, GNAT family
fig|553596.3.peg.2327 Staphylococcus aureus A9781 FIG   Acetyltransferase SERP0113, GNAT family
fig|553601.3.peg.1112 Staphylococcus aureus A10102 FIG   Acetyltransferase SERP0113, GNAT family
fig|585891.3.peg.480 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Acetyltransferase SERP0113, GNAT family
fig|644279.4.peg.548 Staphylococcus aureus subsp. aureus 132 FIG   Acetyltransferase SERP0113, GNAT family
fig|680649.3.peg.2283 Staphylococcus aureus subsp. aureus MR1 FIG   Acetyltransferase SERP0113, GNAT family
fig|681288.4.peg.428 Staphylococcus aureus subsp. aureus ED98 FIG   Acetyltransferase SERP0113, GNAT family
fig|703339.3.peg.457 Staphylococcus aureus 04-02981 FIG   Acetyltransferase SERP0113, GNAT family
fig|93061.3.peg.440 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Acetyltransferase SERP0113, GNAT family
gb|ABD22492.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     acetyltransferase, GNAT family
gb|ABD29600.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ48302.1 Staphylococcus aureus subsp. aureus JH9     GCN5-related N-acetyltransferase
gb|ABR51369.1 Staphylococcus aureus subsp. aureus JH1     GCN5-related N-acetyltransferase
gb|ABX28502.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     possible GNAT family acetyltransferase
gb|EES94166.1 Staphylococcus aureus subsp. aureus USA300_TCH959     GNAT family acetyltransferase
gb|EEV27714.1 Staphylococcus aureus A9781     acetyltransferase
gb|EEV64144.1 Staphylococcus aureus A9763     acetyltransferase
gb|EEV67296.1 Staphylococcus aureus A9719     acetyltransferase
gb|EEV72629.1 Staphylococcus aureus A9299     acetyltransferase
gb|EEV74637.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV78527.1 Staphylococcus aureus A6300     acetyltransferase
gb|EEV81563.1 Staphylococcus aureus A6224     acetyltransferase
gb|EEV82723.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEV84993.1 Staphylococcus aureus A5937     acetyltransferase
gb|EEW45151.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0993
gb|EEW46769.1 Staphylococcus aureus D30     hypothetical protein SAD30_1340
gi|13700367 Staphylococcus aureus subsp. aureus N315 NCBI   conserved hypothetical protein
gi|14246245 Staphylococcus aureus subsp. aureus Mu50 NCBI   conserved hypothetical protein
gi|147740004 Staphylococcus aureus subsp. aureus JH9 NCBI   GCN5-related N-acetyltransferase
gi|148266935 Staphylococcus aureus subsp. aureus JH9 NCBI   GCN5-related N-acetyltransferase
gi|149945433 Staphylococcus aureus subsp. aureus JH1 NCBI   GCN5-related N-acetyltransferase
gi|150373453 Staphylococcus aureus subsp. aureus str. Newman NCBI   acetyltransferase, GNAT family protein
gi|150392981 Staphylococcus aureus subsp. aureus JH1 NCBI   GCN5-related N-acetyltransferase
gi|151220653 Staphylococcus aureus subsp. aureus str. Newman NCBI   acetyltransferase, GNAT family protein
gi|156720940 Staphylococcus aureus subsp. aureus Mu3 NCBI   conserved hypothetical protein
gi|156978805 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0474
gi|15923467 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV0477
gi|15926154 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0435
gi|160367531 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   possible GNAT family acetyltransferase
gi|161508722 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   GNAT family acetyltransferase
gi|221139118 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   GNAT family acetyltransferase
gi|221142548 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   GNAT family acetyltransferase
gi|253725437 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   GNAT family acetyltransferase
gi|253730825 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   GNAT family acetyltransferase
gi|255005270 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   acetyltransferase
gi|257789374 Staphylococcus aureus A9781 NCBI   acetyltransferase
gi|257795402 Staphylococcus aureus A9781 NCBI   acetyltransferase
gi|257839675 Staphylococcus aureus A9763 NCBI   acetyltransferase
gi|257842874 Staphylococcus aureus A9719 NCBI   acetyltransferase
gi|257848642 Staphylococcus aureus A9299 NCBI   acetyltransferase
gi|257850689 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257855592 Staphylococcus aureus A6300 NCBI   acetyltransferase
gi|257858689 Staphylococcus aureus A6224 NCBI   acetyltransferase
gi|257859883 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|257862220 Staphylococcus aureus A5937 NCBI   acetyltransferase
gi|258413428 Staphylococcus aureus A9763 NCBI   acetyltransferase
gi|258421450 Staphylococcus aureus A9719 NCBI   acetyltransferase
gi|258436851 Staphylococcus aureus A9299 NCBI   acetyltransferase
gi|258444430 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258445642 Staphylococcus aureus A6300 NCBI   acetyltransferase
gi|258448174 Staphylococcus aureus A6224 NCBI   acetyltransferase
gi|258452483 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258456008 Staphylococcus aureus A5937 NCBI   acetyltransferase
gi|259160119 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0993
gi|259162193 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1340
gi|87127978 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   acetyltransferase, GNAT family
gi|87162004 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   acetyltransferase
gi|87201790 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194232 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00441
img|637092046 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637098975 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637887105 Staphylococcus aureus aureus USA300 IMG   acetyltransferase, GNAT family( EC:2.3.1.- )
img|637893099 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639109800 Staphylococcus aureus aureus JH1 IMG   GCN5-related N-acetyltransferase
img|640564827 Staphylococcus aureus aureus JH9 IMG   GCN5-related N-acetyltransferase
img|640778579 Staphylococcus aureus aureus JH1 IMG   GCN5-related N-acetyltransferase
img|640794801 Staphylococcus aureus aureus Newman IMG   acetyltransferase, GNAT family protein
img|640903197 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641308432 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   possible GNAT family acetyltransferase( EC:2.3.1.- )
img|641773373 Staphylococcus aureus aureus USA300_TCH959 IMG   possible GNAT family acetyltransferase
kegg|saa:SAUSA300_0451 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   acetyltransferase (EC:2.3.1.-)
kegg|sae:NWMN_0441 Staphylococcus aureus subsp. aureus Newman KEGG   acetyltransferase, GNAT family protein
kegg|sah:SaurJH1_0511 Staphylococcus aureus subsp. aureus JH1 KEGG   GCN5-related N-acetyltransferase
kegg|saj:SaurJH9_0498 Staphylococcus aureus subsp. aureus JH9 KEGG   GCN5-related N-acetyltransferase
kegg|sao:SAOUHSC_00441 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sau:SA0435   KEGG   hypothetical protein
kegg|sav:SAV0477   KEGG   hypothetical protein
kegg|saw:SAHV_0474 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_0476 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   GNAT family acetyltransferase (EC:2.3.1.-)
ref|NP_371001.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV0477
ref|NP_373687.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0435
ref|YP_001245878.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   GCN5-related N-acetyltransferase
ref|YP_001315656.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   GCN5-related N-acetyltransferase
ref|YP_001331475.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   acetyltransferase, GNAT family protein
ref|YP_001441064.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0474
ref|YP_001574381.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   GNAT family acetyltransferase
ref|YP_493163.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   acetyltransferase
ref|YP_499024.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00441
ref|ZP_03563918.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   GNAT family acetyltransferase
ref|ZP_03567041.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   GNAT family acetyltransferase
ref|ZP_04864990.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   GNAT family acetyltransferase
ref|ZP_05143871.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   acetyltransferase
ref|ZP_05644381.1 Staphylococcus aureus A9781 RefSeq   acetyltransferase
ref|ZP_05681703.1 Staphylococcus aureus A9763 RefSeq   acetyltransferase
ref|ZP_05684377.1 Staphylococcus aureus A9719 RefSeq   acetyltransferase
ref|ZP_05689191.1 Staphylococcus aureus A9299 RefSeq   acetyltransferase
ref|ZP_05692764.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05693822.1 Staphylococcus aureus A6300 RefSeq   acetyltransferase
ref|ZP_05696303.1 Staphylococcus aureus A6224 RefSeq   acetyltransferase
ref|ZP_05700491.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
ref|ZP_05703963.1 Staphylococcus aureus A5937 RefSeq   acetyltransferase
tr|A5IQ29 Staphylococcus aureus (strain JH9) TrEMBL   GCN5-related N-acetyltransferase
tr|A6QED1 Staphylococcus aureus (strain Newman) TrEMBL   Acetyltransferase, GNAT family protein
tr|A6TYV1 Staphylococcus aureus (strain JH1) TrEMBL   GCN5-related N-acetyltransferase
tr|A7WYL5 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8Z0X1 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Possible GNAT family acetyltransferase
tr|C5N1Z8 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   GNAT family acetyltransferase
tr|Q2FJG5 Staphylococcus aureus (strain USA300) TrEMBL   Acetyltransferase, GNAT family
tr|Q2G0T6 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q7A7C8 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA0435
tr|Q99WC6 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search