The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.2685: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Mannose-6-phosphate isomerase (EC 5.3.1.8)
Translate Function Assignments



Context on contig NC_007795 from base 2734627 to 2746128 (11502 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2681 2735154 2734627 528 -           Immunodominant antigen B locus|SAOUHSC_02972, protein_id|YP_501423.1, gi|88196593, geneID|3921673
2682 2735412 2735870 459 + 257         FIG01108077: hypothetical protein locus|SAOUHSC_02973, protein_id|YP_501424.1, gi|88196594, geneID|3921674
2683 2736110 2737984 1875 + 239 5     Activator of the mannose operon (transcriptional antiterminator), BglG family locus|SAOUHSC_02974, protein_id|YP_501425.1, gi|88196595, geneID|3921458
2684 2738061 2740013 1953 + 76 4 1: 1   PTS system, mannose-specific IIB component (EC 2.7.1.69) / PTS system, mannose-specific IIC component / PTS system, mannose-specific IIA component locus|SAOUHSC_02975, protein_id|YP_501426.1, gi|88196596, geneID|3921459
2685 2740027 2740965 939 + 13       Mannose-6-phosphate isomerase (EC 5.3.1.8) locus|SAOUHSC_02976, protein_id|YP_501427.1, gi|88196597, geneID|3921460
2686 2744058 2741077 2982 - 111         Phage infection protein locus|SAOUHSC_02978, protein_id|YP_501428.1, gi|88196598, geneID|3921461
2687 2744269 2746128 1860 + 210         N-acetylmuramoyl-L-alanine amidase, family 4 locus|SAOUHSC_02979, protein_id|YP_501429.1, gi|88196599, geneID|3921462

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.2685 Mannose-6-phosphate isomerase (EC 5.3.1.8)
MALFLQPVFKDRIWGGHALKAFNYDIPNETTGECWAISAHPNGPNTIINGPYKDMTLDQL
WSQHRELFDNDSRDSFPLLTKVLDANDKLSVQVHPDDDYALKHEGELGKTECWYILDAAP
GAEIIYGVHAHNKQTLIDMIDNHEFDSLFKRIPVKPGDFYYVPAGTVHAIGSGILILETQ
QSSDTTYRIYDYDRRDQNGQLRDLHLEQSKDVIELGNHEPNTTPITTHIDTHTVTQFVDN
QYFAVYKWDIHGDLKFNKPHAYCLVTIIDGTGTLTVNDKHYDIQKGSSFILTTEDEDIHF
VGNISAIVSHPG

MD5 = 24d5d8fa9919cebd533b4259e7c2322a


  DNA Sequence

>fig|93061.5.peg.2685 Mannose-6-phosphate isomerase (EC 5.3.1.8)
atggcattatttttacaacccgtttttaaagacagaatttggggcggtcatgcattaaaa
gcatttaactatgatatccctaatgaaacaactggtgaatgctgggcaatttctgcacat
ccaaatggtcctaatacaattatcaatggtccatacaaggatatgaccctagatcaactt
tggtcacaacatcgtgaattattcgataatgattcacgagatagtttccctctgctaact
aaagtattagatgccaatgataaattatctgttcaagttcacccagatgatgactacgct
ttaaaacacgaaggcgaactaggtaaaacagaatgttggtatattttagatgcagcccca
ggtgctgaaattatatatggcgtacatgcacataataaacagacgttaatagacatgatt
gataatcatgaatttgacagtcttttcaaacgtatacctgttaagcccggtgacttttat
tatgttcctgctggcactgtccatgccattggttcgggtattttaattttagagacacaa
caatcctccgatacgacataccgtatttatgactatgatagacgagatcaaaatggtcaa
ttgcgtgatttgcacttagagcaaagtaaagatgtgattgaattaggcaatcatgaacca
aatactactcctataacaactcacatcgacacacacactgtaactcaatttgtagataat
caatattttgcagtatataaatgggatattcatggagatttaaaattcaataaaccacat
gcttattgcttagttacaattatcgatggtactggtactttaacagtaaacgataagcac
tatgacatccaaaaaggttctagctttattttaactacggaagacgaggatattcacttt
gtcggtaatattagtgctatagtaagtcatcctggataa


  DNA with Flanking Sequence

>fig|93061.5.peg.2685 Mannose-6-phosphate isomerase (EC 5.3.1.8)
tgacaatgtagataacaccgcgaaacattcacatctcaataaaccttctcatgtttttga
tcaacaaactatgataattactgatcacgacatgtctcgaaacgaagcaattgatatgtt
gattcataaacttaaaatttgccgttatgtagagcacacatcgcatttaaaaaatgcaat
actagaacgtgaaatggagtctacgacagctattggcatgaacgtggccattccacatgc
aaagtctgatgttgtaaaacaaccgattgtagctgttatgaaaaataatcatggtgttaa
atgggacagtctagatggtagtctacctcaattgatattcttaattgccgtaccaaacaa
cagtcaggatacacatttaaaaatacttcagcgcttatctaaagcgttaatgaatgatga
gacacgccaatcactaattaatgcaaacagtactacagaaatttataacttattaatgaa
aatatagaggagttttaactatggcattatttttacaacccgtttttaaagacagaattt
ggggcggtcatgcattaaaagcatttaactatgatatccctaatgaaacaactggtgaat
gctgggcaatttctgcacatccaaatggtcctaatacaattatcaatggtccatacaagg
atatgaccctagatcaactttggtcacaacatcgtgaattattcgataatgattcacgag
atagtttccctctgctaactaaagtattagatgccaatgataaattatctgttcaagttc
acccagatgatgactacgctttaaaacacgaaggcgaactaggtaaaacagaatgttggt
atattttagatgcagccccaggtgctgaaattatatatggcgtacatgcacataataaac
agacgttaatagacatgattgataatcatgaatttgacagtcttttcaaacgtatacctg
ttaagcccggtgacttttattatgttcctgctggcactgtccatgccattggttcgggta
ttttaattttagagacacaacaatcctccgatacgacataccgtatttatgactatgata
gacgagatcaaaatggtcaattgcgtgatttgcacttagagcaaagtaaagatgtgattg
aattaggcaatcatgaaccaaatactactcctataacaactcacatcgacacacacactg
taactcaatttgtagataatcaatattttgcagtatataaatgggatattcatggagatt
taaaattcaataaaccacatgcttattgcttagttacaattatcgatggtactggtactt
taacagtaaacgataagcactatgacatccaaaaaggttctagctttattttaactacgg
aagacgaggatattcactttgtcggtaatattagtgctatagtaagtcatcctggataat
agcaatgataacaaccgtcccataaaagacagaaattactatctcttctgtctaaaaaca
taaaaatccacacattaaggagctataaccctaatgtgtggatttaatttttattctgta
acgttactttggtcaactttttcagatacgcgcttcatcaatggatctgttacaggtttt
aaaattaaacctacaacgaagaatcctataccaaataacgttaatataattaattttgta
attaggatttccggaacaataccgcctactgtttcacgtaatgaatcaattgcatacgta
aatggtaagtatggcgaaatgttttggaaaaattgtggcgtagtttgaattgggaatgtt
cccccaccacctgcaatttgtaatacaagcaatacgattgcaatggctttacctgggtta
ccaagtaatgatacgcacgtatatacgattgagttgaaaataatcgaacagaaaatcgtt
ataagtacaaataatacag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004476       F:mannose-6-phosphate isomerase activity
GO:0005975       P:carbohydrate metabolic process
GO:0008270       F:zinc ion binding
cmr|NT01SA2688 Staphylococcus aureus N315     mannose-6-phosphate isomerase, class I
cmr|NT02SA2632 Staphylococcus aureus Mu50     mannose-6-phosphate isomerase, class I
cmr|NT03SA2773 Staphylococcus aureus MW2     mannose-6-phosphate isomerase, class I
cmr|NT05SA2659 Staphylococcus aureus NCTC 8325     mannose-6-phosphate isomerase, class I
cmr|NT09SA2535 Staphylococcus aureus subsp. aureus MSSA476     mannose-6-phosphate isomerase, class I
cmr|SACOL2664 Staphylococcus aureus subsp. aureus COL     mannose-6-phosphate isomerase, class I
cmr|SAUSA300_2577 Staphylococcus aureus subsp. aureus USA300-FPR3757     mannose-6-phosphate isomerase, class I
dbj|BAB43740.1 Staphylococcus aureus subsp. aureus N315     mannose-6-phosphate isomerase
dbj|BAB58804.1 Staphylococcus aureus subsp. aureus Mu50     mannose-6-phosphate isomerase
dbj|BAB96428.1 Staphylococcus aureus subsp. aureus MW2     mannose-6-phosphate isomerase
dbj|BAF68813.1 Staphylococcus aureus subsp. aureus str. Newman     mannose-6-phosphate isomerase
dbj|BAF79509.1 Staphylococcus aureus subsp. aureus Mu3     mannose-6-phosphate isomerase
emb|CAG44345.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   mannose-6-phosphate isomerase
fig|158878.1.peg.2642 Staphylococcus aureus subsp. aureus Mu50 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|158878.14.peg.2738 Staphylococcus aureus subsp. aureus Mu50 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|158879.1.peg.2522 Staphylococcus aureus subsp. aureus N315 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|158879.11.peg.2637 Staphylococcus aureus subsp. aureus N315 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|196620.1.peg.2563 Staphylococcus aureus subsp. aureus MW2 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|196620.5.peg.2648 Staphylococcus aureus subsp. aureus MW2 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|282459.1.peg.2508 Staphylococcus aureus subsp. aureus MSSA476 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|282459.5.peg.2633 Staphylococcus aureus subsp. aureus MSSA476 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|359786.13.peg.2812 Staphylococcus aureus subsp. aureus JH9 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|359786.3.peg.1898 Staphylococcus aureus subsp. aureus JH9 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|359787.11.peg.2773 Staphylococcus aureus subsp. aureus JH1 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|359787.3.peg.1058 Staphylococcus aureus subsp. aureus JH1 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|367830.3.peg.2002 Staphylococcus aureus subsp. aureus USA300 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|418127.4.peg.2427 Staphylococcus aureus subsp. aureus Mu3 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|418127.6.peg.2694 Staphylococcus aureus subsp. aureus Mu3 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|426430.6.peg.2453 Staphylococcus aureus subsp. aureus str. Newman FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|426430.8.peg.2754 Staphylococcus aureus subsp. aureus str. Newman FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|451515.3.peg.2757 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|451516.9.peg.2751 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|452948.4.peg.1028 Staphylococcus aureus 930918-3 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|455227.3.peg.1531 Staphylococcus aureus D30 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|505321.3.peg.2188 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|548475.3.peg.1524 Staphylococcus aureus subsp. aureus TCH70 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|553565.3.peg.1071 Staphylococcus aureus A5937 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|553567.3.peg.930 Staphylococcus aureus A5948 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|553568.3.peg.1510 Staphylococcus aureus A6224 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|553571.3.peg.1177 Staphylococcus aureus A6300 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|553573.3.peg.1852 Staphylococcus aureus A8115 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|553574.3.peg.1541 Staphylococcus aureus A8117 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|553577.3.peg.1893 Staphylococcus aureus A8796 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|553580.3.peg.1938 Staphylococcus aureus A8819 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|553581.3.peg.1809 Staphylococcus aureus A9299 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|553588.3.peg.1189 Staphylococcus aureus A9719 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|553590.4.peg.1813 Staphylococcus aureus A9754 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|553592.3.peg.1540 Staphylococcus aureus A9763 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|553594.3.peg.610 Staphylococcus aureus A9765 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|553596.3.peg.321 Staphylococcus aureus A9781 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|553601.3.peg.1250 Staphylococcus aureus A10102 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|585891.3.peg.2728 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|644279.4.peg.13 Staphylococcus aureus subsp. aureus 132 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|680649.3.peg.638 Staphylococcus aureus subsp. aureus MR1 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|681288.4.peg.2677 Staphylococcus aureus subsp. aureus ED98 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|703339.3.peg.2644 Staphylococcus aureus 04-02981 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|762962.3.peg.1863 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|93061.3.peg.2819 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|93062.19.peg.2590 Staphylococcus aureus subsp. aureus COL FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
fig|93062.4.peg.2095 Staphylococcus aureus subsp. aureus COL FIG   Mannose-6-phosphate isomerase (EC 5.3.1.8)
gb|AAW38662.1 Staphylococcus aureus subsp. aureus COL     mannose-6-phosphate isomerase, class I
gb|ABD20780.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     mannose-6-phosphate isomerase, class I
gb|ABD31965.1 Staphylococcus aureus subsp. aureus NCTC 8325     mannose-6-phosphate isomerase, class I
gb|ABQ50442.1 Staphylococcus aureus subsp. aureus JH9     mannose-6-phosphate isomerase, class I
gb|ABR53544.1 Staphylococcus aureus subsp. aureus JH1     mannose-6-phosphate isomerase, class I
gb|ABX30628.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     mannose-6-phosphate isomerase
gb|EES56277.1 Staphylococcus aureus subsp. aureus TCH70     mannose-6-phosphate isomerase
gb|EEV25780.1 Staphylococcus aureus A9781     mannose-6-phosphate isomerase, class I
gb|EEV64576.1 Staphylococcus aureus A9763     mannose-6-phosphate isomerase
gb|EEV67474.1 Staphylococcus aureus A9719     mannose-6-phosphate isomerase, class I
gb|EEV72060.1 Staphylococcus aureus A9299     mannose-6-phosphate isomerase
gb|EEV74863.1 Staphylococcus aureus A8115     mannose-6-phosphate isomerase
gb|EEV77917.1 Staphylococcus aureus A6300     mannose-6-phosphate isomerase
gb|EEV80521.1 Staphylococcus aureus A6224     mannose-6-phosphate isomerase
gb|EEV83789.1 Staphylococcus aureus A5948     mannose-6-phosphate isomerase, class I
gb|EEV86183.1 Staphylococcus aureus A5937     mannose-6-phosphate isomerase, class I
gb|EEW45166.1 Staphylococcus aureus 930918-3     mannose-6-phosphate isomerase
gb|EEW46979.1 Staphylococcus aureus D30     mannose-6-phosphate isomerase
gi|13702600 Staphylococcus aureus subsp. aureus N315 NCBI   mannose-6-phosphate isomerase
gi|14248417 Staphylococcus aureus subsp. aureus Mu50 NCBI   mannose-6-phosphate isomerase
gi|147742144 Staphylococcus aureus subsp. aureus JH9 NCBI   mannose-6-phosphate isomerase, class I
gi|148269075 Staphylococcus aureus subsp. aureus JH9 NCBI   mannose-6-phosphate isomerase
gi|149947608 Staphylococcus aureus subsp. aureus JH1 NCBI   mannose-6-phosphate isomerase, class I
gi|150375553 Staphylococcus aureus subsp. aureus str. Newman NCBI   mannose-6-phosphate isomerase
gi|150395156 Staphylococcus aureus subsp. aureus JH1 NCBI   mannose-6-phosphate isomerase
gi|151222753 Staphylococcus aureus subsp. aureus str. Newman NCBI   mannose-6-phosphate isomerase
gi|156723092 Staphylococcus aureus subsp. aureus Mu3 NCBI   mannose-6-phosphate isomerase
gi|156980957 Staphylococcus aureus subsp. aureus Mu3 NCBI   mannose-6-phosphate isomerase
gi|15925632 Staphylococcus aureus subsp. aureus Mu50 NCBI   mannose-6-phosphate isomerase
gi|15928228 Staphylococcus aureus subsp. aureus N315 NCBI   mannose-6-phosphate isomerase
gi|160369657 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   mannose-6-phosphate isomerase
gi|161510848 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   mannose-6-phosphate isomerase
gi|21205736 Staphylococcus aureus subsp. aureus MW2 NCBI   mannose-6-phosphate isomerase
gi|21284292 Staphylococcus aureus subsp. aureus MW2 NCBI   mannose-6-phosphate isomerase
gi|251803620 Staphylococcus aureus subsp. aureus TCH70 NCBI   mannose-6-phosphate isomerase
gi|251812900 Staphylococcus aureus subsp. aureus TCH70 NCBI   mannose-6-phosphate isomerase
gi|253316646 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   mannose-6-phosphate isomerase
gi|255007414 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   mannose-6-phosphate isomerase
gi|257787440 Staphylococcus aureus A9781 NCBI   mannose-6-phosphate isomerase, class I
gi|257793468 Staphylococcus aureus A9781 NCBI   mannose-6-phosphate isomerase, class I
gi|257840111 Staphylococcus aureus A9763 NCBI   mannose-6-phosphate isomerase
gi|257843059 Staphylococcus aureus A9719 NCBI   mannose-6-phosphate isomerase, class I
gi|257848068 Staphylococcus aureus A9299 NCBI   mannose-6-phosphate isomerase
gi|257850919 Staphylococcus aureus A8115 NCBI   mannose-6-phosphate isomerase
gi|257854974 Staphylococcus aureus A6300 NCBI   mannose-6-phosphate isomerase
gi|257857626 Staphylococcus aureus A6224 NCBI   mannose-6-phosphate isomerase
gi|257860972 Staphylococcus aureus A5948 NCBI   mannose-6-phosphate isomerase, class I
gi|257863423 Staphylococcus aureus A5937 NCBI   mannose-6-phosphate isomerase, class I
gi|258411226 Staphylococcus aureus A9763 NCBI   mannose-6-phosphate isomerase
gi|258420869 Staphylococcus aureus A9719 NCBI   mannose-6-phosphate isomerase, class I
gi|258438509 Staphylococcus aureus A9299 NCBI   mannose-6-phosphate isomerase
gi|258444035 Staphylococcus aureus A8115 NCBI   mannose-6-phosphate isomerase
gi|258446148 Staphylococcus aureus A6300 NCBI   mannose-6-phosphate isomerase
gi|258449193 Staphylococcus aureus A6224 NCBI   mannose-6-phosphate isomerase
gi|258451442 Staphylococcus aureus A5948 NCBI   mannose-6-phosphate isomerase, class I
gi|258454329 Staphylococcus aureus A5937 NCBI   mannose-6-phosphate isomerase, class I
gi|259160135 Staphylococcus aureus 930918-3 NCBI   mannose-6-phosphate isomerase
gi|259162408 Staphylococcus aureus D30 NCBI   mannose-6-phosphate isomerase
gi|49245864 Staphylococcus aureus subsp. aureus MSSA476 NCBI   mannose-6-phosphate isomerase
gi|49487421 Staphylococcus aureus subsp. aureus MSSA476 NCBI   mannose-6-phosphate isomerase
gi|57286568 Staphylococcus aureus subsp. aureus COL NCBI   mannose-6-phosphate isomerase, class I
gi|57652382 Staphylococcus aureus subsp. aureus COL NCBI   mannose-6-phosphate isomerase
gi|87126266 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   mannose-6-phosphate isomerase, class I
gi|87160292 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   mannose-6-phosphate isomerase
gi|87204155 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   mannose-6-phosphate isomerase, class I
gi|88196597 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   mannose-6-phosphate isomerase
img|637094190 Staphylococcus aureus aureus N315 IMG   mannose-6-phosphate isomerase
img|637101199 Staphylococcus aureus aureus Mu50 IMG   mannose-6-phosphate isomerase
img|637153405 Staphylococcus aureus aureus COL IMG   mannose-6-phosphate isomerase, class I( EC:5.3.1.8 )
img|637158799 Staphylococcus aureus aureus MSSA476 IMG   mannose-6-phosphate isomerase( EC:5.3.1.8 )
img|637300380 Staphylococcus aureus aureus MW2 IMG   mannose-6-phosphate isomerase
img|637889219 Staphylococcus aureus aureus USA300 IMG   mannose-6-phosphate isomerase, class I( EC:5.3.1.8 )
img|637895576 Staphylococcus aureus aureus NCTC 8325 IMG   mannose-6-phosphate isomerase, class I( EC:5.3.1.8 )
img|639107536 Staphylococcus aureus aureus JH1 IMG   Mannose-6-phosphate isomerase, type I( EC:5.3.1.8 )
img|640567050 Staphylococcus aureus aureus JH9 IMG   mannose-6-phosphate isomerase, class I( EC:5.3.1.8 )
img|640780831 Staphylococcus aureus aureus JH1 IMG   mannose-6-phosphate isomerase, class I( EC:5.3.1.8 )
img|640796972 Staphylococcus aureus aureus Newman IMG   mannose-6-phosphate isomerase
img|640905424 Staphylococcus aureus aureus Mu3 IMG   mannose-6-phosphate isomerase
img|641310642 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   mannose-6-phosphate isomerase( EC:5.3.1.8 )
img|641773385 Staphylococcus aureus aureus USA300_TCH959 IMG   mannose-6-phosphate isomerase
kegg|saa:SAUSA300_2577 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   mannose-6-phosphate isomerase (EC:5.3.1.8)
kegg|sac:SACOL2664 Staphylococcus aureus subsp. aureus COL KEGG   mannose-6-phosphate isomerase (EC:5.3.1.8)
kegg|sae:NWMN_2541 Staphylococcus aureus subsp. aureus Newman KEGG   mannose-6-phosphate isomerase
kegg|sah:SaurJH1_2722 Staphylococcus aureus subsp. aureus JH1 KEGG   mannose-6-phosphate isomerase (EC:5.3.1.8)
kegg|saj:SaurJH9_2666 Staphylococcus aureus subsp. aureus JH9 KEGG   mannose-6-phosphate isomerase (EC:5.3.1.8)
kegg|sam:MW2563 Staphylococcus aureus subsp. aureus MW2 KEGG   mannose-6-phosphate isomerase
kegg|sao:SAOUHSC_02976 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   mannose-6-phosphate isomerase (EC:5.3.1.8)
kegg|sas:SAS2528   KEGG   mannose-6-phosphate isomerase (EC:5.3.1.8)
kegg|sau:SA2435   KEGG   mannose-6-phosphate isomerase
kegg|sav:SAV2642   KEGG   mannose-6-phosphate isomerase
kegg|saw:SAHV_2626 Staphylococcus aureus subsp. aureus Mu3 KEGG   mannose-6-phosphate isomerase
kegg|sax:USA300HOU_2642 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   mannose-6-phosphate isomerase (EC:5.3.1.8)
ref|NP_373166.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   mannose-6-phosphate isomerase
ref|NP_375761.1 Staphylococcus aureus subsp. aureus N315 RefSeq   mannose-6-phosphate isomerase
ref|NP_647380.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   mannose-6-phosphate isomerase
ref|YP_001248018.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   mannose-6-phosphate isomerase
ref|YP_001317831.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   mannose-6-phosphate isomerase
ref|YP_001333575.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   mannose-6-phosphate isomerase
ref|YP_001443216.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   mannose-6-phosphate isomerase
ref|YP_001576507.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   mannose-6-phosphate isomerase
ref|YP_044642.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   mannose-6-phosphate isomerase
ref|YP_187452.1 Staphylococcus aureus subsp. aureus COL RefSeq   mannose-6-phosphate isomerase
ref|YP_495211.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   mannose-6-phosphate isomerase
ref|YP_501427.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   mannose-6-phosphate isomerase
ref|ZP_04827373.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   mannose-6-phosphate isomerase
ref|ZP_04839859.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   mannose-6-phosphate isomerase
ref|ZP_05146015.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   mannose-6-phosphate isomerase
ref|ZP_05642447.1 Staphylococcus aureus A9781 RefSeq   mannose-6-phosphate isomerase, class I
ref|ZP_05681505.1 Staphylococcus aureus A9763 RefSeq   mannose-6-phosphate isomerase
ref|ZP_05683803.1 Staphylococcus aureus A9719 RefSeq   mannose-6-phosphate isomerase, class I
ref|ZP_05689732.1 Staphylococcus aureus A9299 RefSeq   mannose-6-phosphate isomerase
ref|ZP_05692373.1 Staphylococcus aureus A8115 RefSeq   mannose-6-phosphate isomerase
ref|ZP_05694308.1 Staphylococcus aureus A6300 RefSeq   mannose-6-phosphate isomerase
ref|ZP_05697299.1 Staphylococcus aureus A6224 RefSeq   mannose-6-phosphate isomerase
ref|ZP_05699473.1 Staphylococcus aureus A5948 RefSeq   mannose-6-phosphate isomerase, class I
ref|ZP_05702297.1 Staphylococcus aureus A5937 RefSeq   mannose-6-phosphate isomerase, class I
tr|A5IW69 Staphylococcus aureus (strain JH9) TrEMBL   Mannose-6-phosphate isomerase, class I
tr|A6QKD1 Staphylococcus aureus (strain Newman) TrEMBL   Mannose-6-phosphate isomerase
tr|A6U526 Staphylococcus aureus (strain JH1) TrEMBL   Mannose-6-phosphate isomerase, class I
tr|A7X727 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Mannose-6-phosphate isomerase
tr|A8Z5E1 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Mannose-6-phosphate isomerase
tr|C5QF07 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Mannose-6-phosphate isomerase
tr|Q2FDL7 Staphylococcus aureus (strain USA300) TrEMBL   Mannose-6-phosphate isomerase, class I
tr|Q2G223 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Mannose-6-phosphate isomerase, class I
tr|Q5HCQ5 Staphylococcus aureus (strain COL) TrEMBL   Mannose-6-phosphate isomerase, class I
tr|Q6G632 Staphylococcus aureus (strain MSSA476) TrEMBL   Mannose-6-phosphate isomerase
tr|Q79ZV9 Staphylococcus aureus (strain MW2) TrEMBL   Mannose-6-phosphate isomerase
tr|Q7A373 Staphylococcus aureus (strain N315) TrEMBL   Mannose-6-phosphate isomerase
tr|Q99QZ6 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Mannose-6-phosphate isomerase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|93061.5.peg.2683 Activator of the mannose operon (transcriptional antiterminator), BglG family
4 fig|93061.5.peg.2684 PTS system, mannose-specific IIB component (EC 2.7.1.69) / PTS system, mannose-specific IIC component / PTS system, mannose-specific IIA component


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search