The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.234: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: FIG01108751: hypothetical protein
Translate Function Assignments



Context on contig NC_007795 from base 268755 to 279795 (11041 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
229 269414 268755 660 -       3: 4 3 2   ABC transporter ATP-binding protein locus|SAOUHSC_00249, protein_id|YP_498844.1, gi|88194056, geneID|3919269
230 270348 269428 921 - 13         FIG01107872: hypothetical protein locus|SAOUHSC_00250, protein_id|YP_498845.1, gi|88194057, geneID|3919270
231 271511 270345 1167 - -4         FIG01108048: hypothetical protein locus|SAOUHSC_00251, protein_id|YP_498846.1, gi|88194058, geneID|3919271
232 273102 271579 1524 - 67         FIG01108182: hypothetical protein locus|SAOUHSC_00253, protein_id|YP_498847.1, gi|88194059, geneID|3919272
233 273373 274026 654 + 270         FIG01108255: hypothetical protein locus|SAOUHSC_00254, protein_id|YP_498848.1, gi|88194060, geneID|3919196
234 274060 274647 588 + 33         FIG01108751: hypothetical protein locus|SAOUHSC_00255, protein_id|YP_498849.1, gi|88194061, geneID|3919197
235 275683 274790 894 - 142         Secretory antigen precursor SsaA locus|SAOUHSC_00256, protein_id|YP_498850.1, gi|88194062, geneID|3919198
236 275931 276224 294 + 247     1: 1 dlit(15657139) 6 kDa early secretory antigenic target ESAT-6 (EsxA) locus|SAOUHSC_00257, protein_id|YP_498851.1, gi|88194063, geneID|3919199
237 276308 279337 3030 + 83     1: 1   Putative secretion accessory protein EsaA/YueB locus|SAOUHSC_00258, protein_id|YP_498852.1, gi|88194064, geneID|3919200
238 279337 279795 459 + -1     1: 1   Putative secretion system component EssA locus|SAOUHSC_00259, protein_id|YP_498853.1, gi|88194065, geneID|3919201

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.234 FIG01108751: hypothetical protein
MIIFILITIFAIYYIAMIASLFKSEGFSIIGLILDVVIMGTLIFYYFIGARFVDHDLSNF
LMFMDTGSYIFMYFAIKCLWVKPKVVNYLIAKELGESKEVIEEQELDLQTSKIRGIYFFI
ISVVMLIITKLRMQPELQADAISMNPVFIFVGVIIILIWLVLDIYRKKKYGIFLFKTIVP
LVVTTWIIIATIILS

MD5 = 69139be3f29389531536c6d693540bb7


  DNA Sequence

>fig|93061.5.peg.234 FIG01108751: hypothetical protein
atgataatttttattttaataacaatatttgctatttattatatagctatgattgctagt
ttgtttaaaagtgaaggtttttcaataataggtttaatattagatgttgttataatgggg
acattgattttttactattttataggcgctcgctttgttgatcatgatttaagcaacttt
ttaatgtttatggatactggatcatatatttttatgtactttgcaattaagtgtttatgg
gtgaaacctaaggtagtaaattatttgattgcaaaagaattgggtgaatctaaagaggtc
attgaagagcaggaattagatttacagacatcaaagataagaggtatctactttttcatt
atttcagtagtgatgttaattatcactaaattaagaatgcaacctgagttacaggcagat
gctatatcgatgaatcctgtatttatttttgttggtgttataatcattttaatttggcta
gtactggatatatatcgcaagaaaaaatacggtatattcttattcaagacgatagtgcca
ctagttgttacgacttggattattatagctacaattatactttcgtaa


  DNA with Flanking Sequence

>fig|93061.5.peg.234 FIG01108751: hypothetical protein
tgtacatacaagagaaaaatgaaaattacaaagttgaaaaaagatatgtggttagatatc
tcacacttaacgttattgtgggatatactttgccattgctttttgtatctatttacgttt
ttggtgtagtcggttttggatttgatgttttcaattattgtctaggtattatcttgatgt
tatttatttcttggttaggtttatttttattttataaaaacgaatttgatagtgaaaatc
ctaatcctgcagttaatgccatagcaattattataaaattatttgcttttggaggaatat
tttatataagtctaatagttcctgtaacacagcaagaagagatttttatagggttaagta
tattcatcaatataattgttgatgctcttcttgttaggtcatattttaattacgcgttat
ataagagtattaagaaagatatcgaaaatgaaggtaagacaatgtaaaggaaagacataa
aaaataataggagtctaaccatgataatttttattttaataacaatatttgctatttatt
atatagctatgattgctagtttgtttaaaagtgaaggtttttcaataataggtttaatat
tagatgttgttataatggggacattgattttttactattttataggcgctcgctttgttg
atcatgatttaagcaactttttaatgtttatggatactggatcatatatttttatgtact
ttgcaattaagtgtttatgggtgaaacctaaggtagtaaattatttgattgcaaaagaat
tgggtgaatctaaagaggtcattgaagagcaggaattagatttacagacatcaaagataa
gaggtatctactttttcattatttcagtagtgatgttaattatcactaaattaagaatgc
aacctgagttacaggcagatgctatatcgatgaatcctgtatttatttttgttggtgtta
taatcattttaatttggctagtactggatatatatcgcaagaaaaaatacggtatattct
tattcaagacgatagtgccactagttgttacgacttggattattatagctacaattatac
tttcgtaaacgattttgattaatggggaatgtagagaacatttctttgtaattttataat
cgaataacatacaaaataaagcgaccaattttgcagtgttacgaattgtaaactgcgaac
tggtcgctttttattgatgtcatgattaatttaatggatgtaattatatgatgaaacttc
tgaagcagagatggttcttgatgaaacgatatattcaccaatccagttcatttctgaaat
tagaatacttccatcaatattaactttttcaacgtaggctacatgaccaaatggaccatt
tactgtttgtaaaattgatcctcgtgttgggtgtctatctactttgaagccattgcttga
agcttggcctgcccagtttttagcatctccccaaaatgtactaatcgtgtgtccatcttt
ggcacgtttatcaaagacataccatgtacattgtccagcagtatataagttgttcttact
tgtgataagaggctgatcaatgatttta


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA0227 Staphylococcus aureus NCTC 8325     membrane protein, putative
cmr|SACOL0269 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_0276 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative membrane protein
dbj|BAF66489.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.2205 Staphylococcus aureus subsp. aureus USA300 FIG   FIG01108751: hypothetical protein
fig|426430.6.peg.217 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01108751: hypothetical protein
fig|426430.8.peg.232 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01108751: hypothetical protein
fig|451515.3.peg.338 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   FIG01108751: hypothetical protein
fig|451516.9.peg.328 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01108751: hypothetical protein
fig|452948.4.peg.2260 Staphylococcus aureus 930918-3 FIG   FIG01108751: hypothetical protein
fig|553567.3.peg.2640 Staphylococcus aureus A5948 FIG   FIG01108751: hypothetical protein
fig|553590.4.peg.2631 Staphylococcus aureus A9754 FIG   FIG01108751: hypothetical protein
fig|553594.3.peg.2531 Staphylococcus aureus A9765 FIG   FIG01108751: hypothetical protein
fig|644279.4.peg.348 Staphylococcus aureus subsp. aureus 132 FIG   FIG01108751: hypothetical protein
fig|93061.3.peg.262 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108751: hypothetical protein
fig|93062.19.peg.262 Staphylococcus aureus subsp. aureus COL FIG   FIG01108751: hypothetical protein
fig|93062.4.peg.731 Staphylococcus aureus subsp. aureus COL FIG   FIG01108751: hypothetical protein
gb|AAW38823.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD21177.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative membrane protein
gb|ABD29429.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX28326.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical membrane protein
gb|EEV82196.1 Staphylococcus aureus A5948     conserved hypothetical protein
gi|150373229 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151220429 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0217
gi|160367355 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical membrane protein
gi|161508546 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0295
gi|257859341 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258453131 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|57286729 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57652543 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0269
gi|87126663 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative membrane protein
gi|87160689 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0276
gi|87201619 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194061 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00255
img|637151047 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637886931 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637892923 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640794577 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641308254 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical membrane protein
img|641771824 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical membrane protein
kegg|saa:SAUSA300_0276 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL0269 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0217 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_00255 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_0295 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001331251.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0217
ref|YP_001574205.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_0295
ref|YP_185164.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0269
ref|YP_492990.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0276
ref|YP_498849.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00255
ref|ZP_05701124.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QDQ7 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z0P7 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Hypothetical membrane protein
tr|Q2FJY8 Staphylococcus aureus (strain USA300) TrEMBL   Putative membrane protein
tr|Q2G191 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HJ93 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search