The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.2271: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: DNA topoisomerase III (EC 5.99.1.2)
Translate Function Assignments



Context on contig NC_007795 from base 2315350 to 2330317 (14968 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2264 2316183 2315350 834 -       4: 1 4 2 3   LSU ribosomal protein L2p (L8e) gene_name|rplB, locus|SAOUHSC_02509, protein_id|YP_500976.1, gi|88196159, geneID|3920885
2265 2316491 2316216 276 - 32     3: 1 4 2   LSU ribosomal protein L23p (L23Ae) gene_name|rplW, locus|SAOUHSC_02510, protein_id|YP_500977.1, gi|88196160, geneID|3920886
2266 2317114 2316491 624 - -1     4: 1 4 2 3   LSU ribosomal protein L4p (L1e) gene_name|rplD, locus|SAOUHSC_02511, protein_id|YP_500978.1, gi|88196161, geneID|3920887
2267 2317803 2317141 663 - 26     5: 1 4 2 6 3   LSU ribosomal protein L3p (L3e) gene_name|rplC, locus|SAOUHSC_02512, protein_id|YP_500979.1, gi|88196162, geneID|3920888
2268 2318139 2317831 309 - 27     3: 1 5 3   SSU ribosomal protein S10p (S20e)  
2269 2318496 2318885 390 + 356         Hypothetical protein SAV2252 locus|SAOUHSC_02515, protein_id|YP_500980.1, gi|88196163, geneID|3920889
2270 2320411 2319077 1335 - 191     1: 8   Hypoxanthine/guanine permease PbuG locus|SAOUHSC_02516, protein_id|YP_500981.1, gi|88196164, geneID|3920890
2271 2322659 2320524 2136 - 112     1: 9   DNA topoisomerase III (EC 5.99.1.2) locus|SAOUHSC_02517, protein_id|YP_500982.1, gi|88196165, geneID|3920891
2272 2322846 2323733 888 + 186         Acetyltransferase, GNAT family locus|SAOUHSC_02519, protein_id|YP_500984.1, gi|88196167, geneID|3921110
2273 2323914 2324777 864 + 180         Glucose:proton symporter GlcU locus|SAOUHSC_02520, protein_id|YP_500985.1, gi|88196168, geneID|3921111
2274 2325025 2324894 132 - 116         FIG01107987: hypothetical protein locus|SAOUHSC_02521, protein_id|YP_500986.1, gi|88196169, geneID|3921112
2275 2326122 2325196 927 - 170         Transporter locus|SAOUHSC_02522, protein_id|YP_500987.1, gi|88196170, geneID|3921113
2276 2326237 2326401 165 + 114         Hypothetical protein SAV2259 locus|SAOUHSC_02523, protein_id|YP_500988.1, gi|88196171, geneID|3921114
2277 2326646 2326963 318 + 244         Hypothetical protein SAV2260 locus|SAOUHSC_02524, protein_id|YP_500989.1, gi|88196172, geneID|3921115
2278 2330317 2327150 3168 - 186     1: 7   RND multidrug efflux transporter; Acriflavin resistance protein locus|SAOUHSC_02525, protein_id|YP_500990.1, gi|88196173, geneID|3921116

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
DNA_processing_cluster VeronikaV DNA topoisomerase III (EC 5.99.1.2)


  Protein Sequence

>fig|93061.5.peg.2271 DNA topoisomerase III (EC 5.99.1.2)
MKSLILAEKPSVARDIADALQINQKRNGYFENNQYIVTWALGHLVTNATPEQYDKNLKEW
RLEDLPIIPKYMKTVVIGKTSKQFKTVKALILDNKVKDIIIATDAGREGELVARLILDKV
GNKKPIRRLWISSVTKKAIQQGFKNLKDGRQYNDLYYAALARSEADWIVGINATRALTTK
YDAQLSLGRVQTPTIQLVNTRQQEINQFKPQQYFTLSLTVKGFDFQLESNQRYTNKETLE
QMVNNLKNVDGKIKSVATKHKKSYPQSLYNLTDLQQDMYRRYKIGPKETLNTLQSLYERH
KVVTYPRTDSNYLTTDMVDTMKERIQVTMATTYKDQARPLMSKTFSSKMSIFNNQKVSDH
HAIIPTEVRPVMSDLSNRELKLYDMIVERFLEALMPPHEYDAITVTLEVAGHTFVLKENV
TTVLGFKSIRQGESITEMQQPFSEGDEVKISKTNIREHETTPPEYFNEGSLLKAMENPQN
FIQLKDKKYAQTLKQTGGIGTVATRADIIDKLFNMNAIESRDGKIKVTSKGKQILELAPE
ELTSPLLTAQWEEKLLLIERGKYQAKTFINEMKDFTKDVVNGIKNSDRKYKHDNLTTTEC
PTCGKFMIKVKTKNGQMLVCQDPSCKTKKNVQRKTNARCPNCKKKLTLFGKGKEAVYRCV
CGHSETQAHMDQRMKSKSSGKVSRKEMKKYMNKNEGLDNNPFKDALKNLNL

MD5 = 5e564a43519b194aa94571dbc62083a8


  DNA Sequence

>fig|93061.5.peg.2271 DNA topoisomerase III (EC 5.99.1.2)
atgaaatctttaatattagctgaaaaaccatcagtcgcaagagatattgctgatgcttta
caaataaatcagaagcgtaatggttactttgaaaataaccaatatattgtcacgtgggcg
ttaggtcatctagtgacaaatgcgacacctgaacaatacgataaaaatttaaaggaatgg
cgattagaagaccttccaattatacctaaatatatgaaaactgttgttattggtaaaaca
agcaaacaatttaaaacagtaaaagcgttaattttagataataaagtgaaagatattatt
attgcaacagatgctggacgagaaggtgaactagttgcaagattgattttggataaagtt
ggtaacaaaaagccaatccgtcgattatggattagctcagttactaaaaaagctattcaa
caaggttttaaaaatttaaaagacggtcgtcaatataacgatttgtattatgcagcgtta
gcgagaagtgaggcagattggattgttgggattaatgcaacgcgtgcactaacaacaaag
tatgatgcacagctatccctgggacgtgttcagacaccaacgattcaattagtaaataca
cgacaacaagagattaatcagttcaaaccacaacaatactttacattatcattaacggta
aaagggtttgattttcagctagaatcaaatcagcgatataccaataaagaaactttagaa
cagatggttaataatttgaaaaatgtcgatggtaagattaaatctgttgctactaaacat
aagaagtcgtatccgcaatcactgtacaatttaacagatttacaacaagatatgtataga
cgttataaaattggacctaaagaaacattgaatacacttcaaagcttatatgagagacat
aaagtcgtaacctatccaagaacagattcaaactatttaacaactgatatggtagatact
atgaaagaacgtattcaggtgacgatggcaacaacatataaagaccaagcacgcccatta
atgtctaaaacattttcatcaaaaatgtcgatatttaataatcaaaaagtatctgatcac
catgcaattattcctacagaagtgagacctgtcatgtcagacttaagtaatagagaatta
aagttatacgatatgattgtcgagcgttttttagaagctttaatgcctccgcacgagtat
gacgcgataactgtaactttagaggttgcagggcacacatttgttttgaaagagaatgta
acaactgttttaggttttaaatctattagacaaggtgaatctattacagagatgcaacag
cctttttcagaaggcgatgaagtgaagatttcaaaaacaaatattagagaacatgaaaca
acacctccagaatattttaatgaaggttcgttattaaaagcgatggagaaccctcagaac
tttattcaattgaaggataaaaaatatgcgcaaactttaaaacaaacaggtggtatcggc
acagttgcaacaagggccgacattatcgataaattatttaatatgaatgccattgaatca
agagacggtaaaattaaagtaacgtcaaaaggtaaacaaatattagaattagcaccagaa
gaattaacgtcgccacttttaactgcacaatgggaagaaaaattacttttaattgaacgt
ggtaaatatcaggcgaaaacatttattaatgaaatgaaagattttacgaaagatgttgta
aatgggattaaaaatagtgatcgtaaatataaacacgataatttaacaaccacagaatgc
ccaacgtgtggtaaattcatgattaaagttaaaactaaaaatggtcagatgcttgtgtgc
caagatccatcttgtaagacgaaaaagaatgtacagcgcaaaacaaatgcaagatgtcca
aactgtaaaaagaaattaacgttgtttggtaaagggaaagaagcggtatatcgttgtgtt
tgtggacattctgaaacgcaagcacatatggatcagcgtatgaagtctaaatcctctggt
aaagtatctcgtaaagaaatgaaaaagtatatgaataaaaatgaaggtttagacaataat
ccgtttaaagatgcattaaagaacttgaatttatag


  DNA with Flanking Sequence

>fig|93061.5.peg.2271 DNA topoisomerase III (EC 5.99.1.2)
tcgtcaggttggttcgaagtcattgctttaaatagcgtttcaaacgtatcgacagataat
acataattgtcagccacgaaagggcctatgactttgaatttatttttatcgtatgcaaaa
gacaatatgattgctttgattgaatcgttttctttaatcgaaaatacaccaggtgattca
atcgcatcggttattaatacatctatttcattgtactgttgaggaagtttatataagtat
gatgctgattcataattcgaatgttcaatgaacgattttatttgtgtaatatcatataac
tgaactatgctcatgtcattacctccgtactttttgttacttttattatatagtatttca
actgaaatgaaagttaatagtgatattaacatgttacaatacatttaacacatcatttgc
aatcattgaatttaaatcaaagattagtggaatagatgaagcacgttcgaaataaaagaa
cgtatgagaaaggataatttatgaaatctttaatattagctgaaaaaccatcagtcgcaa
gagatattgctgatgctttacaaataaatcagaagcgtaatggttactttgaaaataacc
aatatattgtcacgtgggcgttaggtcatctagtgacaaatgcgacacctgaacaatacg
ataaaaatttaaaggaatggcgattagaagaccttccaattatacctaaatatatgaaaa
ctgttgttattggtaaaacaagcaaacaatttaaaacagtaaaagcgttaattttagata
ataaagtgaaagatattattattgcaacagatgctggacgagaaggtgaactagttgcaa
gattgattttggataaagttggtaacaaaaagccaatccgtcgattatggattagctcag
ttactaaaaaagctattcaacaaggttttaaaaatttaaaagacggtcgtcaatataacg
atttgtattatgcagcgttagcgagaagtgaggcagattggattgttgggattaatgcaa
cgcgtgcactaacaacaaagtatgatgcacagctatccctgggacgtgttcagacaccaa
cgattcaattagtaaatacacgacaacaagagattaatcagttcaaaccacaacaatact
ttacattatcattaacggtaaaagggtttgattttcagctagaatcaaatcagcgatata
ccaataaagaaactttagaacagatggttaataatttgaaaaatgtcgatggtaagatta
aatctgttgctactaaacataagaagtcgtatccgcaatcactgtacaatttaacagatt
tacaacaagatatgtatagacgttataaaattggacctaaagaaacattgaatacacttc
aaagcttatatgagagacataaagtcgtaacctatccaagaacagattcaaactatttaa
caactgatatggtagatactatgaaagaacgtattcaggtgacgatggcaacaacatata
aagaccaagcacgcccattaatgtctaaaacattttcatcaaaaatgtcgatatttaata
atcaaaaagtatctgatcaccatgcaattattcctacagaagtgagacctgtcatgtcag
acttaagtaatagagaattaaagttatacgatatgattgtcgagcgttttttagaagctt
taatgcctccgcacgagtatgacgcgataactgtaactttagaggttgcagggcacacat
ttgttttgaaagagaatgtaacaactgttttaggttttaaatctattagacaaggtgaat
ctattacagagatgcaacagcctttttcagaaggcgatgaagtgaagatttcaaaaacaa
atattagagaacatgaaacaacacctccagaatattttaatgaaggttcgttattaaaag
cgatggagaaccctcagaactttattcaattgaaggataaaaaatatgcgcaaactttaa
aacaaacaggtggtatcggcacagttgcaacaagggccgacattatcgataaattattta
atatgaatgccattgaatcaagagacggtaaaattaaagtaacgtcaaaaggtaaacaaa
tattagaattagcaccagaagaattaacgtcgccacttttaactgcacaatgggaagaaa
aattacttttaattgaacgtggtaaatatcaggcgaaaacatttattaatgaaatgaaag
attttacgaaagatgttgtaaatgggattaaaaatagtgatcgtaaatataaacacgata
atttaacaaccacagaatgcccaacgtgtggtaaattcatgattaaagttaaaactaaaa
atggtcagatgcttgtgtgccaagatccatcttgtaagacgaaaaagaatgtacagcgca
aaacaaatgcaagatgtccaaactgtaaaaagaaattaacgttgtttggtaaagggaaag
aagcggtatatcgttgtgtttgtggacattctgaaacgcaagcacatatggatcagcgta
tgaagtctaaatcctctggtaaagtatctcgtaaagaaatgaaaaagtatatgaataaaa
atgaaggtttagacaataatccgtttaaagatgcattaaagaacttgaatttatagataa
aatcgaacaaagttgaatcagaaaaacgaaaagttcgcttttggtattgttttttattaa
gaatgatattaaactattaaggtattttaaaaaaaggagcatccattcgtgaaaaactat
ttccagttcgataaatatggaacaaactttaaaagagaaatcttaggcggtatcacaact
ttcttatctatggcctatattttagcagttaacccgcaagttttaagtttagcaggtgtt
aaaggcgtatcagaagatatgaaaatggaccaaggtgccatttttgtagcgactgcatta
gcagcatttgtaggctcgctattcatggggctaatagctaaatatccaattgcgttagca
ccaggtatgggattaaatgcattctttgcatttactgttgtgttaaccatgggtattcct
tggcaagttggtttaacaggcgttttattctcaggtatattctttgcgatattaaccgtc
acagggtttagggaag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003917       F:DNA topoisomerase type I activity
GO:0005524       F:ATP binding
GO:0005694       C:chromosome
GO:0006265       P:DNA topological change
GO:0006268       P:DNA unwinding during replication
cmr|NT05SA2269 Staphylococcus aureus NCTC 8325     DNA topoisomerase III
fig|93061.3.peg.2374 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   DNA topoisomerase III (EC 5.99.1.2)
gb|ABD31533.1 Staphylococcus aureus subsp. aureus NCTC 8325     DNA topoisomerase III, putative
gi|122538856 organism not parsed/found in ncbi nr NCBI   RecName: Full=DNA topoisomerase 3; AltName: Full=DNA topoisomerase III
gi|87203723 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   DNA topoisomerase III, putative
gi|88196165 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   DNA topoisomerase III
img|637895131 Staphylococcus aureus aureus NCTC 8325 IMG   DNA topoisomerase III, putative( EC:5.99.1.2 )
kegg|sao:SAOUHSC_02517 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   DNA topoisomerase III (EC:5.99.1.2)
ref|YP_500982.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   DNA topoisomerase III
sp|Q2FW03 Staphylococcus aureus (strain NCTC 8325) SwissProt   DNA topoisomerase 3
sp|TOP3_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=DNA topoisomerase 3; AltName: Full=DNA topoisomerase III


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search