The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.2245: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Translation initiation factor 1
Translate Function Assignments



Context on contig NC_007795 from base 2301224 to 2312243 (11020 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2237 2302030 2301224 807 -       4: 9 7 8 6   ECF transporter, transmembrane component of energizing module locus|SAOUHSC_02481, protein_id|YP_500949.1, gi|88196132, geneID|3920858
2238 2302880 2302020 861 - -11     5: 11 9 7 8 6   ECF transporter, ATPase component of energizing module gene_name|cbiO, locus|SAOUHSC_02482, protein_id|YP_500950.1, gi|88196133, geneID|3920859
2239 2303686 2302877 810 - -4     6: 11 9 7 12 8 6   ATPase component of general energizing module of ECF transporters gene_name|cbiO, locus|SAOUHSC_02483, protein_id|YP_500951.1, gi|88196134, geneID|3920860
2240 2304592 2304224 369 - 537 14 3: 1 3 2   LSU ribosomal protein L17p gene_name|rplQ, locus|SAOUHSC_02484, protein_id|YP_500952.1, gi|88196135, geneID|3920861
2241 2305553 2304609 945 - 16 19 1: 19   DNA-directed RNA polymerase alpha subunit (EC 2.7.7.6) locus|SAOUHSC_02485, protein_id|YP_500953.1, gi|88196136, geneID|3920862
2242 2306017 2305628 390 - 74 22 3: 1 4 5   SSU ribosomal protein S11p (S14e) locus|SAOUHSC_02486, protein_id|YP_500954.1, gi|88196137, geneID|3920863
2243 2306406 2306041 366 - 23 25 3: 1 4 5   SSU ribosomal protein S13p (S18e) gene_name|rpsM, locus|SAOUHSC_02487, protein_id|YP_500955.1, gi|88196138, geneID|3920864
2244 2306542 2306429 114 - 22 9 3: 3 2 10   LSU ribosomal protein L36p @ LSU ribosomal protein L36p, zinc-dependent gene_name|rpmJ, locus|SAOUHSC_02488, protein_id|YP_500956.1, gi|88196139, geneID|3920865
2245 2306792 2306574 219 - 31   2: 14 22   Translation initiation factor 1 gene_name|infA, locus|SAOUHSC_02489, protein_id|YP_500957.1, gi|88196140, geneID|3920866
2246 2307632 2306985 648 - 192     5: 20 18 21 17 15   Adenylate kinase (EC 2.7.4.3) gene_name|adk, locus|SAOUHSC_02490, protein_id|YP_500958.1, gi|88196141, geneID|3920867
2247 2308941 2307649 1293 - 16 13 1: 16   Protein translocase subunit SecY gene_name|secY, locus|SAOUHSC_02491, protein_id|YP_500959.1, gi|88196142, geneID|3920868
2248 2309381 2308941 441 - -1 16 3: 1 3 2   LSU ribosomal protein L15p (L27Ae) gene_name|rplO, locus|SAOUHSC_02492, protein_id|YP_500960.1, gi|88196143, geneID|3920869
2249 2309577 2309398 180 - 16 15 2: 3 2   LSU ribosomal protein L30p (L7e) gene_name|rpmD, locus|SAOUHSC_02493, protein_id|YP_500961.1, gi|88196144, geneID|3920870
2250 2310094 2309594 501 - 16 16 4: 1 4 13 5   SSU ribosomal protein S5p (S2e) gene_name|rpsE, locus|SAOUHSC_02494, protein_id|YP_500962.1, gi|88196145, geneID|3920871
2251 2310474 2310115 360 - 20 17 3: 1 3 2   LSU ribosomal protein L18p (L5e) gene_name|rplR, locus|SAOUHSC_02495, protein_id|YP_500963.1, gi|88196146, geneID|3920872
2252 2311041 2310505 537 - 30 12 4: 1 3 2 5 dlit(17923494)
dlit(19289529)
LSU ribosomal protein L6p (L9e) gene_name|rplF, locus|SAOUHSC_02496, protein_id|YP_500964.1, gi|88196147, geneID|3920873
2253 2311464 2311066 399 - 24 15 2: 1 4   SSU ribosomal protein S8p (S15Ae) gene_name|rpsH, locus|SAOUHSC_02498, protein_id|YP_500965.1, gi|88196148, geneID|3920874
2254 2311681 2311496 186 - 31 10 2: 4 10   SSU ribosomal protein S14p (S29e) @ SSU ribosomal protein S14p (S29e), zinc-dependent gene_name|rpsN, locus|SAOUHSC_02499, protein_id|YP_500966.2, gi|161353519, geneID|3920875
2255 2312243 2311704 540 - 22 14 4: 1 3 2 5   LSU ribosomal protein L5p (L11e) gene_name|rplE, locus|SAOUHSC_02500, protein_id|YP_500967.1, gi|88196150, geneID|3920876

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Translation_initiation_factors_bacterial gjo Translation initiation factor 1
ClpS-AAT vcrecy Translation initiation factor 1


  Protein Sequence

>fig|93061.5.peg.2245 Translation initiation factor 1
MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPY
DLTRGRITYRYK

MD5 = b6822cdc23c0804223e8e7afea912939


  DNA Sequence

>fig|93061.5.peg.2245 Translation initiation factor 1
atggctaaacaagatgtaattgaattagaaggtactgtattagatactttaccgaacgca
atgtttaaagtagaattagaaaatggtcatgagattttagctcacgtaagtggtaaaatc
agaatgaattacattcgtattctacctggcgacaaagtaactgttgagatgtctccgtac
gatttaacacgcggaagaattacttatcgttataaataa


  DNA with Flanking Sequence

>fig|93061.5.peg.2245 Translation initiation factor 1
aagttccggaagaagaattaatgaaccgtcttacaggtcgtcgaatctgtgagtcatgtg
gtacaacgtatcatcttgtatttaatcctccgaaggtcgaaggtatttgtgatatcgatg
gtggtaaattgtatcaacgagaagatgataatcctgaaacggtagctaatcgtttgagtg
ttaatattaaacaatctaagcctattttagatttctatgatcaaaaaggtgtattgaaaa
atattgatggttcaaaagatattagcgacgttaccaaagatgtcattgatattttagatc
atttgtaatagatcaacttttagcggtctattttaagtgaggcatgatttaatcatatta
gatagatgagagtggcaattaacgataattaattcccgtaatttttgtttaacttataaa
attaatcactgatagattcgtaacaataaagttgtctattgacgattaccttactattgc
aaaaagggggaagttaatcaatggctaaacaagatgtaattgaattagaaggtactgtat
tagatactttaccgaacgcaatgtttaaagtagaattagaaaatggtcatgagattttag
ctcacgtaagtggtaaaatcagaatgaattacattcgtattctacctggcgacaaagtaa
ctgttgagatgtctccgtacgatttaacacgcggaagaattacttatcgttataaataat
cgtcactccataatatagggaggtataaaaatgaaagtaagaccatcagtaaaacctatt
tgcgaaaaatgtaaagtcattaaacgtaaaggtaaagtaatggtaatttgtgaaaatcca
aaacacaaacaaagacaaggttaataaaagagaggtgtaaattaatatggcacgtattgc
aggagtagatattccacgtgaaaaacgcgtagttatctcattaacttatatatacggtat
cggtacgtcaactgctcaaaaaattcttgaagaagctaacgtatcagctgatactcgtgt
gaaagatttaactgatgacgaattaggtcgcatccgtgaagttgtagacggttataaagt
cgaaggtgacttacgtcgtgaaactaacttaaatatcaaacgtttaatggaaatttcatc
ataccgtggtatccgtcaccgtcgtggtttaccagttcgtggtcaaaaaacgaaaaacaa
cgcgcgtactcgtaaagga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003723       F:RNA binding
GO:0003743       F:translation initiation factor activity
GO:0005737       C:cytoplasm
GO:0006413       P:translational initiation
cmr|NT01SA2237 Staphylococcus aureus N315     translation initiation factor IF-1
cmr|NT02SA2234 Staphylococcus aureus Mu50     translation initiation factor IF-1
cmr|NT03SA2318 Staphylococcus aureus MW2     translation initiation factor IF-1
cmr|NT03SS0688 Staphylococcus saprophyticus ATCC15305     translation initiation factor IF-1
cmr|NT05SA2243 Staphylococcus aureus NCTC 8325     translation initiation factor IF-1
cmr|NT08SA2287 Staphylococcus aureus subsp. aureus MRSA252     translation initiation factor IF-1
cmr|NT09SA2135 Staphylococcus aureus subsp. aureus MSSA476     translation initiation factor IF-1
cmr|NT11SA2110 Staphylococcus aureus RF122     translation initiation factor IF-1
cmr|SACOL2217 Staphylococcus aureus subsp. aureus COL     translation initiation factor IF-1
cmr|SAUSA300_2182 Staphylococcus aureus subsp. aureus USA300-FPR3757     translation initiation factor IF-1
dbj|BAB43320.1 Staphylococcus aureus subsp. aureus N315     translation initiation factor IF-1
dbj|BAB58390.1 Staphylococcus aureus subsp. aureus Mu50     translation initiation factor IF-1
dbj|BAB96012.1 Staphylococcus aureus subsp. aureus MW2     translation initiation factor IF-1
dbj|BAE17830.1 Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305     translation initiation factor IF-1
dbj|BAF68402.1 Staphylococcus aureus subsp. aureus str. Newman     translation initiation factor IF-1
dbj|BAF79095.1 Staphylococcus aureus subsp. aureus Mu3     translation initiation factor IF-1
dbj|BAH16924.1 Macrococcus caseolyticus JCSC5402     translation initiation factor IF-1
emb|CAG41294.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   translation initiation factor IF-1
emb|CAG43930.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   translation initiation factor IF-1
emb|CAI81789.1 Staphylococcus aureus RF122 EMBL   translation initiation factor IF-1
emb|CAL28619.1 Staphylococcus carnosus subsp. carnosus TM300 EMBL   translation initiation factor IF-1
fig|158878.1.peg.2228 Staphylococcus aureus subsp. aureus Mu50 FIG   Translation initiation factor 1
fig|158878.14.peg.2303 Staphylococcus aureus subsp. aureus Mu50 FIG   Translation initiation factor 1
fig|158879.1.peg.2103 Staphylococcus aureus subsp. aureus N315 FIG   Translation initiation factor 1
fig|158879.11.peg.2194 Staphylococcus aureus subsp. aureus N315 FIG   Translation initiation factor 1
fig|196620.1.peg.2147 Staphylococcus aureus subsp. aureus MW2 FIG   Translation initiation factor 1
fig|196620.5.peg.2218 Staphylococcus aureus subsp. aureus MW2 FIG   Translation initiation factor 1
fig|273036.3.peg.2055 Staphylococcus aureus RF122 FIG   Translation initiation factor 1
fig|273036.6.peg.2213 Staphylococcus aureus RF122 FIG   Translation initiation factor 1
fig|282458.1.peg.2185 Staphylococcus aureus subsp. aureus MRSA252 FIG   Translation initiation factor 1
fig|282458.4.peg.2325 Staphylococcus aureus subsp. aureus MRSA252 FIG   Translation initiation factor 1
fig|282459.1.peg.2097 Staphylococcus aureus subsp. aureus MSSA476 FIG   Translation initiation factor 1
fig|282459.5.peg.2203 Staphylococcus aureus subsp. aureus MSSA476 FIG   Translation initiation factor 1
fig|342451.11.peg.687 Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 FIG   Translation initiation factor 1
fig|342451.4.peg.1012 Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 FIG   Translation initiation factor 1
fig|359786.13.peg.2383 Staphylococcus aureus subsp. aureus JH9 FIG   Translation initiation factor 1
fig|359786.3.peg.318 Staphylococcus aureus subsp. aureus JH9 FIG   Translation initiation factor 1
fig|359787.11.peg.2346 Staphylococcus aureus subsp. aureus JH1 FIG   Translation initiation factor 1
fig|359787.3.peg.53 Staphylococcus aureus subsp. aureus JH1 FIG   Translation initiation factor 1
fig|367830.3.peg.1422 Staphylococcus aureus subsp. aureus USA300 FIG   Translation initiation factor 1
fig|396513.4.peg.1710 Staphylococcus carnosus subsp. carnosus TM300 FIG   Translation initiation factor 1
fig|418127.4.peg.2046 Staphylococcus aureus subsp. aureus Mu3 FIG   Translation initiation factor 1
fig|418127.6.peg.2268 Staphylococcus aureus subsp. aureus Mu3 FIG   Translation initiation factor 1
fig|426430.6.peg.2069 Staphylococcus aureus subsp. aureus str. Newman FIG   Translation initiation factor 1
fig|426430.8.peg.2317 Staphylococcus aureus subsp. aureus str. Newman FIG   Translation initiation factor 1
fig|450394.6.peg.1436 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Translation initiation factor 1
fig|451515.3.peg.2323 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Translation initiation factor 1
fig|451516.9.peg.2312 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Translation initiation factor 1
fig|452948.4.peg.1118 Staphylococcus aureus 930918-3 FIG   Translation initiation factor 1
fig|455227.3.peg.446 Staphylococcus aureus D30 FIG   Translation initiation factor 1
fig|458233.11.peg.290 Macrococcus caseolyticus JCSC5402 FIG   Translation initiation factor 1
fig|505321.3.peg.2556 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Translation initiation factor 1
fig|546342.3.peg.1972 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Translation initiation factor 1
fig|546343.3.peg.176 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Translation initiation factor 1
fig|548470.3.peg.1125 Staphylococcus aureus subsp. aureus MN8 FIG   Translation initiation factor 1
fig|548473.3.peg.371 Staphylococcus aureus subsp. aureus TCH60 FIG   Translation initiation factor 1
fig|548474.3.peg.654 Staphylococcus aureus subsp. aureus TCH130 FIG   Translation initiation factor 1
fig|548475.3.peg.1945 Staphylococcus aureus subsp. aureus TCH70 FIG   Translation initiation factor 1
fig|553565.3.peg.2182 Staphylococcus aureus A5937 FIG   Translation initiation factor 1
fig|553567.3.peg.269 Staphylococcus aureus A5948 FIG   Translation initiation factor 1
fig|553568.3.peg.2552 Staphylococcus aureus A6224 FIG   Translation initiation factor 1
fig|553571.3.peg.1706 Staphylococcus aureus A6300 FIG   Translation initiation factor 1
fig|553573.3.peg.613 Staphylococcus aureus A8115 FIG   Translation initiation factor 1
fig|553574.3.peg.1011 Staphylococcus aureus A8117 FIG   Translation initiation factor 1
fig|553577.3.peg.49 Staphylococcus aureus A8796 FIG   Translation initiation factor 1
fig|553580.3.peg.51 Staphylococcus aureus A8819 FIG   Translation initiation factor 1
fig|553581.3.peg.2672 Staphylococcus aureus A9299 FIG   Translation initiation factor 1
fig|553583.3.peg.190 Staphylococcus aureus A9635 FIG   Translation initiation factor 1
fig|553590.4.peg.826 Staphylococcus aureus A9754 FIG   Translation initiation factor 1
fig|553592.3.peg.1122 Staphylococcus aureus A9763 FIG   Translation initiation factor 1
fig|553594.3.peg.1108 Staphylococcus aureus A9765 FIG   Translation initiation factor 1
fig|553596.3.peg.1469 Staphylococcus aureus A9781 FIG   Translation initiation factor 1
fig|553601.3.peg.451 Staphylococcus aureus A10102 FIG   Translation initiation factor 1
fig|585143.3.peg.368 Staphylococcus aureus subsp. aureus 55/2053 FIG   Translation initiation factor 1
fig|585144.3.peg.677 Staphylococcus aureus subsp. aureus 58-424 FIG   Translation initiation factor 1
fig|585145.3.peg.487 Staphylococcus aureus subsp. aureus 65-1322 FIG   Translation initiation factor 1
fig|585146.3.peg.59 Staphylococcus aureus subsp. aureus 68-397 FIG   Translation initiation factor 1
fig|585147.3.peg.1778 Staphylococcus aureus subsp. aureus A017934/97 FIG   Translation initiation factor 1
fig|585148.3.peg.2002 Staphylococcus aureus subsp. aureus Btn1260 FIG   Translation initiation factor 1
fig|585149.6.peg.2396 Staphylococcus aureus subsp. aureus C101 FIG   Translation initiation factor 1
fig|585150.3.peg.611 Staphylococcus aureus subsp. aureus C160 FIG   Translation initiation factor 1
fig|585151.3.peg.1938 Staphylococcus aureus subsp. aureus C427 FIG   Translation initiation factor 1
fig|585152.3.peg.2198 Staphylococcus aureus subsp. aureus D139 FIG   Translation initiation factor 1
fig|585153.3.peg.491 Staphylococcus aureus subsp. aureus E1410 FIG   Translation initiation factor 1
fig|585154.3.peg.2283 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Translation initiation factor 1
fig|585155.3.peg.765 Staphylococcus aureus subsp. aureus H19 FIG   Translation initiation factor 1
fig|585156.3.peg.1775 Staphylococcus aureus subsp. aureus M1015 FIG   Translation initiation factor 1
fig|585157.3.peg.1892 Staphylococcus aureus subsp. aureus M809 FIG   Translation initiation factor 1
fig|585158.3.peg.269 Staphylococcus aureus subsp. aureus M876 FIG   Translation initiation factor 1
fig|585159.3.peg.2324 Staphylococcus aureus subsp. aureus M899 FIG   Translation initiation factor 1
fig|585160.3.peg.2033 Staphylococcus aureus subsp. aureus WBG10049 FIG   Translation initiation factor 1
fig|585161.3.peg.2054 Staphylococcus aureus subsp. aureus WW2703/97 FIG   Translation initiation factor 1
fig|585891.3.peg.2299 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Translation initiation factor 1
fig|644279.4.peg.2364 Staphylococcus aureus subsp. aureus 132 FIG   Translation initiation factor 1
fig|680649.3.peg.1331 Staphylococcus aureus subsp. aureus MR1 FIG   Translation initiation factor 1
fig|681288.4.peg.2246 Staphylococcus aureus subsp. aureus ED98 FIG   Translation initiation factor 1
fig|703339.3.peg.2209 Staphylococcus aureus 04-02981 FIG   Translation initiation factor 1
fig|762962.3.peg.2290 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Translation initiation factor 1
fig|93061.3.peg.2349 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Translation initiation factor 1
fig|93062.19.peg.2162 Staphylococcus aureus subsp. aureus COL FIG   Translation initiation factor 1
fig|93062.4.peg.2273 Staphylococcus aureus subsp. aureus COL FIG   Translation initiation factor 1
gb|AAW37092.1 Staphylococcus aureus subsp. aureus COL     translation initiation factor IF-1
gb|ABD21567.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     translation initiation factor IF-1
gb|ABD31508.1 Staphylococcus aureus subsp. aureus NCTC 8325     translation initiation factor IF-1
gb|ABQ50035.1 Staphylococcus aureus subsp. aureus JH9     bacterial translation initiation factor 1 (bIF-1)
gb|ABR53121.1 Staphylococcus aureus subsp. aureus JH1     translation initiation factor IF-1
gb|ABX30212.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     protein-synthesizing GTPase
gb|EEI96558.1 Staphylococcus aureus subsp. aureus MN8     translation initiation factor IF-1
gb|EEJ62552.1 Staphylococcus aureus subsp. aureus TCH60     translation initiation factor IF-1
gb|EES55775.1 Staphylococcus aureus subsp. aureus TCH70     translation initiation factor IF-1
gb|EES95070.1 Staphylococcus aureus subsp. aureus USA300_TCH959     translation initiation factor IF-1
gb|EES96409.1 Staphylococcus aureus subsp. aureus TCH130     translation initiation factor IF-1
gb|EEV04833.1 Staphylococcus aureus subsp. aureus 55/2053     translation initiation factor IF-1
gb|EEV07473.1 Staphylococcus aureus subsp. aureus 65-1322     translation initiation factor IF-1
gb|EEV10098.1 Staphylococcus aureus subsp. aureus 68-397     translation initiation factor IF-1
gb|EEV12687.1 Staphylococcus aureus subsp. aureus E1410     translation initiation factor IF-1
gb|EEV15349.1 Staphylococcus aureus subsp. aureus M876     translation initiation factor IF-1
gb|EEV26886.1 Staphylococcus aureus A9781     translation initiation factor IF-1
gb|EEV64967.1 Staphylococcus aureus A9763     translation initiation factor IF-1
gb|EEV71095.1 Staphylococcus aureus A9635     translation initiation factor IF-1
gb|EEV71590.1 Staphylococcus aureus A9299     translation initiation factor IF-1
gb|EEV75687.1 Staphylococcus aureus A8115     translation initiation factor IF-1
gb|EEV77685.1 Staphylococcus aureus A6300     translation initiation factor IF-1
gb|EEV79214.1 Staphylococcus aureus A6224     translation initiation factor IF-1
gb|EEV84361.1 Staphylococcus aureus A5948     translation initiation factor IF-1
gb|EEV85394.1 Staphylococcus aureus A5937     translation initiation factor IF-1
gb|EEW45108.1 Staphylococcus aureus 930918-3     translation initiation factor IF-1
gb|EEW47911.1 Staphylococcus aureus D30     translation initiation factor IF-1
gi|119371121 organism not parsed/found in ncbi nr NCBI   RecName: Full=Translation initiation factor IF-1
gi|119371122 organism not parsed/found in ncbi nr NCBI   RecName: Full=Translation initiation factor IF-1
gi|119371123 organism not parsed/found in ncbi nr NCBI   RecName: Full=Translation initiation factor IF-1
gi|119371125 organism not parsed/found in ncbi nr NCBI   RecName: Full=Translation initiation factor IF-1
gi|13702028 Staphylococcus aureus subsp. aureus N315 NCBI   translation initiation factor IF-1
gi|14248001 Staphylococcus aureus subsp. aureus Mu50 NCBI   translation initiation factor IF-1
gi|147741737 Staphylococcus aureus subsp. aureus JH9 NCBI   bacterial translation initiation factor 1 (bIF-1)
gi|148268668 Staphylococcus aureus subsp. aureus JH9 NCBI   translation initiation factor IF-1
gi|149947185 Staphylococcus aureus subsp. aureus JH1 NCBI   translation initiation factor IF-1
gi|150375142 Staphylococcus aureus subsp. aureus str. Newman NCBI   translation initiation factor IF-1
gi|150394733 Staphylococcus aureus subsp. aureus JH1 NCBI   translation initiation factor IF-1
gi|151222342 Staphylococcus aureus subsp. aureus str. Newman NCBI   translation initiation factor IF-1
gi|156722678 Staphylococcus aureus subsp. aureus Mu3 NCBI   translation initiation factor IF-1
gi|156980543 Staphylococcus aureus subsp. aureus Mu3 NCBI   translation initiation factor IF-1
gi|15925218 Staphylococcus aureus subsp. aureus Mu50 NCBI   translation initiation factor IF-1
gi|15927808 Staphylococcus aureus subsp. aureus N315 NCBI   translation initiation factor IF-1
gi|160369241 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   protein-synthesizing GTPase
gi|161510432 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   translation initiation factor IF-1
gi|190359708 organism not parsed/found in ncbi nr NCBI   RecName: Full=Translation initiation factor IF-1
gi|190359709 organism not parsed/found in ncbi nr NCBI   RecName: Full=Translation initiation factor IF-1
gi|190359710 organism not parsed/found in ncbi nr NCBI   RecName: Full=Translation initiation factor IF-1
gi|190359711 organism not parsed/found in ncbi nr NCBI   RecName: Full=Translation initiation factor IF-1
gi|190359712 organism not parsed/found in ncbi nr NCBI   RecName: Full=Translation initiation factor IF-1
gi|21205318 Staphylococcus aureus subsp. aureus MW2 NCBI   translation initiation factor IF-1
gi|21283876 Staphylococcus aureus subsp. aureus MW2 NCBI   translation initiation factor IF-1
gi|221138930 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   translation initiation factor IF-1
gi|221140170 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   translation initiation factor IF-1
gi|222119589 Macrococcus caseolyticus JCSC5402 NCBI   translation initiation factor IF-1
gi|222150467 Macrococcus caseolyticus JCSC5402 NCBI   translation initiation factor IF-1
gi|222421805 Staphylococcus carnosus subsp. carnosus TM300 NCBI   translation initiation factor IF-1
gi|224477198 Staphylococcus carnosus subsp. carnosus TM300 NCBI   translation initiation factor IF-1
gi|227246799 Staphylococcus aureus subsp. aureus MN8 NCBI   translation initiation factor IF-1
gi|227556941 Staphylococcus aureus subsp. aureus MN8 NCBI   translation initiation factor IF-1
gi|227852754 Staphylococcus aureus subsp. aureus TCH60 NCBI   translation initiation factor IF-1
gi|227899001 Staphylococcus aureus subsp. aureus TCH60 NCBI   translation initiation factor IF-1
gi|251803118 Staphylococcus aureus subsp. aureus TCH70 NCBI   translation initiation factor IF-1
gi|251813345 Staphylococcus aureus subsp. aureus TCH70 NCBI   translation initiation factor IF-1
gi|253316989 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   translation initiation factor IF-1
gi|253726341 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   translation initiation factor IF-1
gi|253727680 Staphylococcus aureus subsp. aureus TCH130 NCBI   translation initiation factor IF-1
gi|253729894 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   translation initiation factor IF-1
gi|253734363 Staphylococcus aureus subsp. aureus TCH130 NCBI   translation initiation factor IF-1
gi|255007008 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   translation initiation factor IF-1
gi|257272731 Staphylococcus aureus subsp. aureus 55/2053 NCBI   translation initiation factor IF-1
gi|257276022 Staphylococcus aureus subsp. aureus 65-1322 NCBI   translation initiation factor IF-1
gi|257279511 Staphylococcus aureus subsp. aureus 68-397 NCBI   translation initiation factor IF-1
gi|257282555 Staphylococcus aureus subsp. aureus E1410 NCBI   translation initiation factor IF-1
gi|257285233 Staphylococcus aureus subsp. aureus M876 NCBI   translation initiation factor IF-1
gi|257423713 Staphylococcus aureus subsp. aureus 55/2053 NCBI   translation initiation factor IF-1
gi|257426391 Staphylococcus aureus subsp. aureus 65-1322 NCBI   translation initiation factor IF-1
gi|257429030 Staphylococcus aureus subsp. aureus 68-397 NCBI   translation initiation factor IF-1
gi|257431676 Staphylococcus aureus subsp. aureus E1410 NCBI   translation initiation factor IF-1
gi|257434637 Staphylococcus aureus subsp. aureus M876 NCBI   translation initiation factor IF-1
gi|257788546 Staphylococcus aureus A9781 NCBI   translation initiation factor IF-1
gi|257794574 Staphylococcus aureus A9781 NCBI   translation initiation factor IF-1
gi|257840507 Staphylococcus aureus A9763 NCBI   translation initiation factor IF-1
gi|257847086 Staphylococcus aureus A9635 NCBI   translation initiation factor IF-1
gi|257847588 Staphylococcus aureus A9299 NCBI   translation initiation factor IF-1
gi|257851753 Staphylococcus aureus A8115 NCBI   translation initiation factor IF-1
gi|257854737 Staphylococcus aureus A6300 NCBI   translation initiation factor IF-1
gi|257856305 Staphylococcus aureus A6224 NCBI   translation initiation factor IF-1
gi|257861559 Staphylococcus aureus A5948 NCBI   translation initiation factor IF-1
gi|257862626 Staphylococcus aureus A5937 NCBI   translation initiation factor IF-1
gi|258408824 Staphylococcus aureus A9763 NCBI   translation initiation factor IF-1
gi|258422675 Staphylococcus aureus A9635 NCBI   translation initiation factor IF-1
gi|258439812 Staphylococcus aureus A9299 NCBI   translation initiation factor IF-1
gi|258442632 Staphylococcus aureus A8115 NCBI   translation initiation factor IF-1
gi|258446669 Staphylococcus aureus A6300 NCBI   translation initiation factor IF-1
gi|258450213 Staphylococcus aureus A6224 NCBI   translation initiation factor IF-1
gi|258450776 Staphylococcus aureus A5948 NCBI   translation initiation factor IF-1
gi|258455415 Staphylococcus aureus A5937 NCBI   translation initiation factor IF-1
gi|259160075 Staphylococcus aureus 930918-3 NCBI   translation initiation factor IF-1
gi|259163353 Staphylococcus aureus D30 NCBI   translation initiation factor IF-1
gi|49242573 Staphylococcus aureus subsp. aureus MRSA252 NCBI   translation initiation factor IF-1
gi|49245453 Staphylococcus aureus subsp. aureus MSSA476 NCBI   translation initiation factor IF-1
gi|49484444 Staphylococcus aureus subsp. aureus MRSA252 NCBI   translation initiation factor IF-1
gi|49487010 Staphylococcus aureus subsp. aureus MSSA476 NCBI   translation initiation factor IF-1
gi|54037369 organism not parsed/found in ncbi nr NCBI   RecName: Full=Translation initiation factor IF-1
gi|54037370 organism not parsed/found in ncbi nr NCBI   RecName: Full=Translation initiation factor IF-1
gi|54041103 organism not parsed/found in ncbi nr NCBI   RecName: Full=Translation initiation factor IF-1
gi|56748906 organism not parsed/found in ncbi nr NCBI   RecName: Full=Translation initiation factor IF-1
gi|56748917 organism not parsed/found in ncbi nr NCBI   RecName: Full=Translation initiation factor IF-1
gi|57284998 Staphylococcus aureus subsp. aureus COL NCBI   translation initiation factor IF-1
gi|57650812 Staphylococcus aureus subsp. aureus COL NCBI   translation initiation factor IF-1
gi|71152147 organism not parsed/found in ncbi nr NCBI   RecName: Full=Translation initiation factor IF-1
gi|72494509 Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 NCBI   translation initiation factor IF-1
gi|73661994 Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 NCBI   translation initiation factor IF-1
gi|82657348 Staphylococcus aureus RF122 NCBI   translation initiation factor IF-1
gi|82751817 Staphylococcus aureus RF122 NCBI   translation initiation factor IF-1
gi|87127053 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   translation initiation factor IF-1
gi|87161079 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   translation initiation factor IF-1
gi|87203698 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   translation initiation factor IF-1
gi|88196140 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   translation initiation factor IF-1
img|637093771 Staphylococcus aureus aureus N315 IMG   translation initiation factor IF-1
img|637100785 Staphylococcus aureus aureus Mu50 IMG   translation initiation factor IF-1
img|637152980 Staphylococcus aureus aureus COL IMG   translation initiation factor IF-1
img|637155746 Staphylococcus aureus aureus MRSA252 IMG   translation initiation factor IF-1
img|637158388 Staphylococcus aureus aureus MSSA476 IMG   translation initiation factor IF-1
img|637299964 Staphylococcus aureus aureus MW2 IMG   translation initiation factor IF-1
img|637696022 Staphylococcus saprophyticus saprophyticus ATCC 15305 IMG   translation initiation factor IF-1
img|637817082 Staphylococcus aureus RF122 IMG   translation initiation factor IF-1
img|637888825 Staphylococcus aureus aureus USA300 IMG   translation initiation factor IF-1
img|637895106 Staphylococcus aureus aureus NCTC 8325 IMG   translation initiation factor IF-1
img|639109366 Staphylococcus aureus aureus JH1 IMG   Translation initiation factor IF-1
img|640566643 Staphylococcus aureus aureus JH9 IMG   translation initiation factor IF-1
img|640780408 Staphylococcus aureus aureus JH1 IMG   translation initiation factor IF-1
img|640796561 Staphylococcus aureus aureus Newman IMG   translation initiation factor IF-1
img|640905010 Staphylococcus aureus aureus Mu3 IMG   translation initiation factor IF-1
img|641310226 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   protein-synthesizing GTPase( EC:3.6.5.3 )
img|641772583 Staphylococcus aureus aureus USA300_TCH959 IMG   protein-synthesizing GTPase
kegg|mcl:MCCL_0217 Macrococcus caseolyticus JCSC5402 KEGG   translation initiation factor IF-1
kegg|saa:SAUSA300_2182 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   translation initiation factor IF-1
kegg|sab:SAB2100c Staphylococcus aureus RF122 KEGG   translation initiation factor IF-1
kegg|sac:SACOL2217 Staphylococcus aureus subsp. aureus COL KEGG   translation initiation factor IF-1
kegg|sae:NWMN_2130 Staphylococcus aureus subsp. aureus Newman KEGG   translation initiation factor IF-1
kegg|sah:SaurJH1_2296 Staphylococcus aureus subsp. aureus JH1 KEGG   translation initiation factor IF-1
kegg|saj:SaurJH9_2255 Staphylococcus aureus subsp. aureus JH9 KEGG   translation initiation factor IF-1
kegg|sam:MW2147 Staphylococcus aureus subsp. aureus MW2 KEGG   translation initiation factor IF-1
kegg|sao:SAOUHSC_02489 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   translation initiation factor IF-1
kegg|sar:SAR2313   KEGG   translation initiation factor IF-1
kegg|sas:SAS2119   KEGG   translation initiation factor IF-1
kegg|sau:SA2026   KEGG   translation initiation factor IF-1
kegg|sav:SAV2228   KEGG   translation initiation factor IF-1
kegg|saw:SAHV_2212 Staphylococcus aureus subsp. aureus Mu3 KEGG   translation initiation factor IF-1
kegg|sax:USA300HOU_2219 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   translation initiation factor IF-1 (EC:3.6.5.3)
kegg|sca:Sca_1713 Staphylococcus carnosus subsp. carnosus TM300 KEGG   translation initiation factor IF-1
kegg|ssp:SSP0685 Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 KEGG   translation initiation factor IF-1
ref|NP_372752.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   translation initiation factor IF-1
ref|NP_375341.1 Staphylococcus aureus subsp. aureus N315 RefSeq   translation initiation factor IF-1
ref|NP_646964.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   translation initiation factor IF-1
ref|YP_001247611.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   translation initiation factor IF-1
ref|YP_001317408.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   translation initiation factor IF-1
ref|YP_001333164.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   translation initiation factor IF-1
ref|YP_001442802.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   translation initiation factor IF-1
ref|YP_001576091.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   translation initiation factor IF-1
ref|YP_002559620.1 Macrococcus caseolyticus JCSC5402 RefSeq   translation initiation factor IF-1
ref|YP_002634804.1 Staphylococcus carnosus subsp. carnosus TM300 RefSeq   translation initiation factor IF-1
ref|YP_041668.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   translation initiation factor IF-1
ref|YP_044231.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   translation initiation factor IF-1
ref|YP_187027.1 Staphylococcus aureus subsp. aureus COL RefSeq   translation initiation factor IF-1
ref|YP_300775.1 Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 RefSeq   translation initiation factor IF-1
ref|YP_417558.1 Staphylococcus aureus RF122 RefSeq   translation initiation factor IF-1
ref|YP_494817.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   translation initiation factor IF-1
ref|YP_500957.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   translation initiation factor IF-1
ref|ZP_03563731.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   translation initiation factor IF-1
ref|ZP_03564663.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   translation initiation factor IF-1
ref|ZP_03986988.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   translation initiation factor IF-1
ref|ZP_04016806.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   translation initiation factor IF-1
ref|ZP_04827818.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   translation initiation factor IF-1
ref|ZP_04840202.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   translation initiation factor IF-1
ref|ZP_04864059.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   translation initiation factor IF-1
ref|ZP_04868528.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   translation initiation factor IF-1
ref|ZP_05145609.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   translation initiation factor IF-1
ref|ZP_05600142.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   translation initiation factor IF-1
ref|ZP_05602793.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   translation initiation factor IF-1
ref|ZP_05605417.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   translation initiation factor IF-1
ref|ZP_05608039.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   translation initiation factor IF-1
ref|ZP_05610688.1 Staphylococcus aureus subsp. aureus M876 RefSeq   translation initiation factor IF-1
ref|ZP_05643553.1 Staphylococcus aureus A9781 RefSeq   translation initiation factor IF-1
ref|ZP_05681108.1 Staphylococcus aureus A9763 RefSeq   translation initiation factor IF-1
ref|ZP_05685580.1 Staphylococcus aureus A9635 RefSeq   translation initiation factor IF-1
ref|ZP_05690558.1 Staphylococcus aureus A9299 RefSeq   translation initiation factor IF-1
ref|ZP_05691192.1 Staphylococcus aureus A8115 RefSeq   translation initiation factor IF-1
ref|ZP_05694824.1 Staphylococcus aureus A6300 RefSeq   translation initiation factor IF-1
ref|ZP_05698305.1 Staphylococcus aureus A6224 RefSeq   translation initiation factor IF-1
ref|ZP_05698835.1 Staphylococcus aureus A5948 RefSeq   translation initiation factor IF-1
ref|ZP_05703375.1 Staphylococcus aureus A5937 RefSeq   translation initiation factor IF-1
sp|A5IV12 Staphylococcus aureus (strain JH9) SwissProt   RecName: Full=Translation initiation factor IF-1
sp|A6QJ70 Staphylococcus aureus (strain Newman) SwissProt   RecName: Full=Translation initiation factor IF-1
sp|A6U3V3 Staphylococcus aureus (strain JH1) SwissProt   RecName: Full=Translation initiation factor IF-1
sp|A7X5D0 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   RecName: Full=Translation initiation factor IF-1
sp|A8Z335 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   RecName: Full=Translation initiation factor IF-1
sp|IF1_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Translation initiation factor IF-1
sp|IF1_STAA2 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Translation initiation factor IF-1
sp|IF1_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Translation initiation factor IF-1
sp|IF1_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Translation initiation factor IF-1
sp|IF1_STAA9 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Translation initiation factor IF-1
sp|IF1_STAAB organism not parsed/found in ncbi nr SwissProt   RecName: Full=Translation initiation factor IF-1
sp|IF1_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Translation initiation factor IF-1
sp|IF1_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=Translation initiation factor IF-1
sp|IF1_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=Translation initiation factor IF-1
sp|IF1_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=Translation initiation factor IF-1
sp|IF1_STAAR organism not parsed/found in ncbi nr SwissProt   RecName: Full=Translation initiation factor IF-1
sp|IF1_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=Translation initiation factor IF-1
sp|IF1_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=Translation initiation factor IF-1
sp|IF1_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=Translation initiation factor IF-1
sp|IF1_STAS1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Translation initiation factor IF-1
sp|P65118 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   RecName: Full=Translation initiation factor IF-1
sp|P65119 Staphylococcus aureus (strain N315) SwissProt   RecName: Full=Translation initiation factor IF-1
sp|P65120 Staphylococcus aureus (strain MW2) SwissProt   RecName: Full=Translation initiation factor IF-1
sp|Q2FER1 Staphylococcus aureus (strain USA300) SwissProt   RecName: Full=Translation initiation factor IF-1
sp|Q2FW28 Staphylococcus aureus (strain NCTC 8325) SwissProt   RecName: Full=Translation initiation factor IF-1
sp|Q2YYL9 Staphylococcus aureus (strain bovine RF122 / ET3-1) SwissProt   RecName: Full=Translation initiation factor IF-1
sp|Q49ZE6 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Translation initiation factor IF-1
sp|Q5HDY0 Staphylococcus aureus (strain COL) SwissProt   RecName: Full=Translation initiation factor IF-1
sp|Q6G793 Staphylococcus aureus (strain MSSA476) SwissProt   RecName: Full=Translation initiation factor IF-1
sp|Q6GEK5 Staphylococcus aureus (strain MRSA252) SwissProt   RecName: Full=Translation initiation factor IF-1
tr|B9DM55 Staphylococcus carnosus (strain TM300) TrEMBL   Translation initiation factor IF-1
tr|B9E9L3 Macrococcus caseolyticus (strain JCSC5402) TrEMBL   Translation initiation factor IF-1
tr|C2G8X3 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   Translation initiation factor IF-1
tr|C2K4E8 Staphylococcus aureus subsp. aureus MN8 TrEMBL   Translation initiation factor IF-1
tr|C5MZ86 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Translation initiation factor IF-1
tr|C5Q309 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Translation initiation factor IF-1
tr|C5QGA2 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Translation initiation factor IF-1


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
14 fig|93061.5.peg.2240 LSU ribosomal protein L17p
19 fig|93061.5.peg.2241 DNA-directed RNA polymerase alpha subunit (EC 2.7.7.6)
22 fig|93061.5.peg.2242 SSU ribosomal protein S11p (S14e)
25 fig|93061.5.peg.2243 SSU ribosomal protein S13p (S18e)
9 fig|93061.5.peg.2244 LSU ribosomal protein L36p @ LSU ribosomal protein L36p, zinc-dependent
13 fig|93061.5.peg.2247 Protein translocase subunit SecY
16 fig|93061.5.peg.2248 LSU ribosomal protein L15p (L27Ae)
15 fig|93061.5.peg.2249 LSU ribosomal protein L30p (L7e)
16 fig|93061.5.peg.2250 SSU ribosomal protein S5p (S2e)
17 fig|93061.5.peg.2251 LSU ribosomal protein L18p (L5e)
12 fig|93061.5.peg.2252 LSU ribosomal protein L6p (L9e)
15 fig|93061.5.peg.2253 SSU ribosomal protein S8p (S15Ae)
10 fig|93061.5.peg.2254 SSU ribosomal protein S14p (S29e) @ SSU ribosomal protein S14p (S29e), zinc-dependent
14 fig|93061.5.peg.2255 LSU ribosomal protein L5p (L11e)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search