The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.2095: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)
Translate Function Assignments



Context on contig NC_007795 from base 2135298 to 2147798 (12501 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2088 2135468 2135298 171 -       2: 21 11   Programmed cell death antitoxin MazE locus|SAOUHSC_02304, protein_id|YP_500783.1, gi|88195970, geneID|3919175
2089 2136701 2135553 1149 - 84     12: 8 15 5 3 12 14 19 9 20 10 7 17   Alanine racemase (EC 5.1.1.1) locus|SAOUHSC_02305, protein_id|YP_500784.1, gi|88195971, geneID|3920930
2090 2137126 2136767 360 - 65     5: 16 5 3 13 18   Holo-[acyl-carrier protein] synthase (EC 2.7.8.7) gene_name|acpS, locus|SAOUHSC_02306, protein_id|YP_500785.1, gi|88195972, geneID|3920931
2091 2137621 2137130 492 - 3     2: 2 6   Hypothetical protein, ydbS homolog locus|SAOUHSC_02307, protein_id|YP_500786.1, gi|88195973, geneID|3920932
2092 2139191 2137608 1584 - -14     2: 2 6   Transmembrane protein, distant homology with YdbT locus|SAOUHSC_02308, protein_id|YP_500787.1, gi|88195974, geneID|3920933
2093 2139663 2139184 480 - -8         Hypothetical protein SAV2074 locus|SAOUHSC_02309, protein_id|YP_500788.1, gi|88195975, geneID|3920934
2094 2140432 2139872 561 - 208 48 1: 1   K+-transporting ATPase chain C (EC 7.2.2.6) locus|SAOUHSC_02310, protein_id|YP_500789.1, gi|88195976, geneID|3920935
2095 2142479 2140452 2028 - 19   1: 1   Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1) locus|SAOUHSC_02311, protein_id|YP_500790.1, gi|88195977, geneID|3920936
2096 2144174 2142498 1677 - 18 47 1: 1   Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1) locus|SAOUHSC_02312, protein_id|YP_500791.1, gi|88195978, geneID|3920937
2097 2144446 2147103 2658 + 271 47 2: 1 4   Osmosensitive K+ channel KdpD, turgor pressure sensor / Osmosensitive K+ channel KdpD, histidine kinase locus|SAOUHSC_02314, protein_id|YP_500793.1, gi|88195980, geneID|3920939
2098 2147103 2147798 696 + -1 21 1: 4   DNA-binding response regulator KdpE locus|SAOUHSC_02315, protein_id|YP_500794.1, gi|88195981, geneID|3920940

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Potassium_homeostasis OlgaV Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)


  Protein Sequence

>fig|93061.5.peg.2095 Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)
MHHVNKYFNQTMVIEALKMSFYKLNLKQLIKNPIMFVVEVGMILTLILICFPDIFGTSYL
SRGYLITIFIILLITILFANFSEAFAEGRGKAQADSLRQAQSNLTARLIEENGAYRIVNA
TELKAGQNIRVENGETIPADGVVINGLATVDESAITGESAPVIKESGGDFDGVIGGTLVT
SDWLEIRVESEAGTSFLDKMIALVEGAERNKTPNEIALFTLLTTLTIIFLVVIVTLYPIA
SYLHLILPIAMLIALTVCLIPTTIGGLLSAIGIAGMDRVTQFNVLAKSGRAVEVCGDVDV
MILDKTGTITYGNRIASEFLPVNQQMLEKLIVAAYMSSIYDDTPEGKSIVRLAKQMYINE
LPKDIDGTYKPFTAETRMSGIITNEISVFKGAPNSMINLVKQQQGNIPLNIESLCMDVSS
KGGTPLIVIENNVMLGVIYLKDVIKDGLVERFTELRKMGIETVMCTGDNALTAATIAKEA
GVDRFVAECKPEDKIKVIKDEQAKGHIVAMTGDGTNDAPALAQANIGLAMNSGTISAKEA
ANLIDLDSNPTKLIEVVKIGKQLLMTRGALTTFSLANDVAKYFAILPALMMSTIPEMTSL
NIMHLSSPKSAIISALIFNALIIVALIPIAMKGVKVKGYSIDRIFINNMLIYGLGGLIVP
FLGIKLIDMIVQFFV

MD5 = 799be08c5939e066223750568b8190fc


  DNA Sequence

>fig|93061.5.peg.2095 Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)
atgcatcatgtaaataaatatttcaatcaaacaatggtgatagaagctttgaaaatgagt
ttttataagctgaatcttaaacaattaataaaaaatccgataatgtttgtcgttgaggtt
ggaatgattttaacgttgatattaatatgttttcctgacatatttggaactagctatcta
tcgcgaggttatttgattacaatttttatcatattattaataactatattgtttgctaat
ttttcagaagcctttgctgaaggtcgtggaaaagcgcaagctgatagtttaagacaagca
caatcaaatttaactgctcgattgatagaagaaaatggtgcgtatcggatagtgaacgcc
acagagttaaaagccggacaaaatattcgggtagaaaatggagaaacaatccctgctgat
ggcgttgtaataaatggattagcaaccgttgatgaatctgcaattactggtgagtctgca
cctgtgataaaagaatcaggtggcgattttgatggagtcattggcggtacacttgtaaca
tctgattggttagaaatacgtgttgagagtgaagcgggtacatcttttttagataaaatg
attgccttagttgaaggggcggaaagaaataaaacaccaaatgaaattgcactttttaca
ttattaacaacgttaacaattatatttttagtcgttattgtaacgttatatccaatagca
tcttacctgcatttaattttacctattgcgatgctcattgcgttaacagtatgtttaata
ccaacgacaatcggtggtttgttatcggcgattggtattgcaggcatggatcgtgttact
caattcaatgtattagcgaaaagtgggcgtgctgtagaagtatgtggagatgtcgatgta
atgattttagacaagacaggcacaatcacttatggcaatcgaatcgctagtgaattttta
ccagtgaatcaacaaatgcttgaaaaattgatagtcgctgcttatatgtcatcaatctac
gatgatacgccagaaggaaaaagtattgtacgattagcgaagcagatgtatataaatgag
ctgcctaaagacattgatggcacatataagccttttacagctgaaactagaatgagcgga
atcattacaaatgaaatatcggtattcaaaggtgcacctaatagtatgataaatcttgtc
aaacaacaacaaggcaatattcctcttaatattgagtctctctgtatggatgtatcgagt
aaaggtggcacaccattaatagtcattgaaaacaatgtcatgcttggcgtgatttattta
aaagatgtgattaaagatggtcttgtagaacgatttactgaattgagaaaaatggggatt
gaaacagttatgtgtacaggtgataatgctttaacagcagctacaattgcaaaagaagcc
ggggttgatagatttgttgcagagtgtaaacccgaagataaaattaaagtcatcaaagat
gaacaagcgaaaggccatattgttgcgatgacaggagatggtacaaatgatgcacctgcg
ctagcacaagcgaatataggattagctatgaactcagggacaattagtgctaaagaggca
gctaatctaattgatttagattcgaatcctacaaagttaatagaggttgtaaaaataggc
aaacaattattaatgacgagaggtgcattaacgacatttagtttggctaatgacgtagca
aaatactttgcaattttacctgcactaatgatgtcaacaattccagaaatgacttcacta
aatattatgcatttatcgtcacctaaatctgcaattatatcagctttgatattcaatgca
ttaatcattgttgccttaattccaattgccatgaaaggtgtaaaagtaaagggttacagc
attgatagaatctttataaataatatgttgatttatggattaggtggattaatcgtcccg
tttttaggcattaaattaatagatatgattgtacaattttttgtgtaa


  DNA with Flanking Sequence

>fig|93061.5.peg.2095 Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)
aaacaccagaatatttaaatatgccaattggcgcccgtgaaatgaaatgtattgtcttag
tctttctcatacacccaattttaattttagtattttcagcacttgcttttatgattcctg
gagcaagtgaaagtataacgaatccgtcttttcatggtatttcacaagttatgtatgaaa
tgacatcagctgctgcgaacaatggatcagggtttgaaggactgaaagatgatacaacat
tctggaatatctctacaggaatcattatgttgctttctcgttatataccaattattttgc
aattaatgattgcatcaagtttagtgaataaaaaatcataccatcaagataaatatacaa
tagcgattgataaaccttattttggcgtatcactaatcgtatttatcgttttactaagtg
gtttgacatttattccagtactattacttggtcctattggtgaatttttaactttaaaat
aaagtaaagggatggaaaaaatgcatcatgtaaataaatatttcaatcaaacaatggtga
tagaagctttgaaaatgagtttttataagctgaatcttaaacaattaataaaaaatccga
taatgtttgtcgttgaggttggaatgattttaacgttgatattaatatgttttcctgaca
tatttggaactagctatctatcgcgaggttatttgattacaatttttatcatattattaa
taactatattgtttgctaatttttcagaagcctttgctgaaggtcgtggaaaagcgcaag
ctgatagtttaagacaagcacaatcaaatttaactgctcgattgatagaagaaaatggtg
cgtatcggatagtgaacgccacagagttaaaagccggacaaaatattcgggtagaaaatg
gagaaacaatccctgctgatggcgttgtaataaatggattagcaaccgttgatgaatctg
caattactggtgagtctgcacctgtgataaaagaatcaggtggcgattttgatggagtca
ttggcggtacacttgtaacatctgattggttagaaatacgtgttgagagtgaagcgggta
catcttttttagataaaatgattgccttagttgaaggggcggaaagaaataaaacaccaa
atgaaattgcactttttacattattaacaacgttaacaattatatttttagtcgttattg
taacgttatatccaatagcatcttacctgcatttaattttacctattgcgatgctcattg
cgttaacagtatgtttaataccaacgacaatcggtggtttgttatcggcgattggtattg
caggcatggatcgtgttactcaattcaatgtattagcgaaaagtgggcgtgctgtagaag
tatgtggagatgtcgatgtaatgattttagacaagacaggcacaatcacttatggcaatc
gaatcgctagtgaatttttaccagtgaatcaacaaatgcttgaaaaattgatagtcgctg
cttatatgtcatcaatctacgatgatacgccagaaggaaaaagtattgtacgattagcga
agcagatgtatataaatgagctgcctaaagacattgatggcacatataagccttttacag
ctgaaactagaatgagcggaatcattacaaatgaaatatcggtattcaaaggtgcaccta
atagtatgataaatcttgtcaaacaacaacaaggcaatattcctcttaatattgagtctc
tctgtatggatgtatcgagtaaaggtggcacaccattaatagtcattgaaaacaatgtca
tgcttggcgtgatttatttaaaagatgtgattaaagatggtcttgtagaacgatttactg
aattgagaaaaatggggattgaaacagttatgtgtacaggtgataatgctttaacagcag
ctacaattgcaaaagaagccggggttgatagatttgttgcagagtgtaaacccgaagata
aaattaaagtcatcaaagatgaacaagcgaaaggccatattgttgcgatgacaggagatg
gtacaaatgatgcacctgcgctagcacaagcgaatataggattagctatgaactcaggga
caattagtgctaaagaggcagctaatctaattgatttagattcgaatcctacaaagttaa
tagaggttgtaaaaataggcaaacaattattaatgacgagaggtgcattaacgacattta
gtttggctaatgacgtagcaaaatactttgcaattttacctgcactaatgatgtcaacaa
ttccagaaatgacttcactaaatattatgcatttatcgtcacctaaatctgcaattatat
cagctttgatattcaatgcattaatcattgttgccttaattccaattgccatgaaaggtg
taaaagtaaagggttacagcattgatagaatctttataaataatatgttgatttatggat
taggtggattaatcgtcccgtttttaggcattaaattaatagatatgattgtacaatttt
ttgtgtaaagaggaaggagcctgtaccatgaatacgataagaaatagtatttgtttaacg
ataataactatggtattatgtggatttttattcccgttagctatcacgttaattggtcaa
atatttttttatcaacaagcaaatggcagtttaattacgtatgacaatcgtatagttgga
tcaaaattgattggacagcactggacagagacacgatattttcacgggagaccgagtgca
gttgattataatatgaatcctgaaaaattatataaaaacggcgtatcttcaggtggaagt
aatgaatcgaatggaaacaccgaattaatagcacgcatgaaacatcatgttaaatttggg
aattcaaatgtaacaatagatgctgcaacaagttctgggtcgggcttagatccgcatatt
acggtcgaaaatgcattgaagcaagcacctcgtattgctgatgctcgtcatgtatctact
tcaagagtggccgacttgattcaacatc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0000287       F:magnesium ion binding
GO:0005524       F:ATP binding
GO:0005886       C:plasma membrane
GO:0006754       P:ATP biosynthetic process
GO:0006813       P:potassium ion transport
GO:0008556       F:potassium-transporting ATPase activity
GO:0016021       C:integral to membrane
GO:0030955       F:potassium ion binding
cmr|NT05SA2085 Staphylococcus aureus NCTC 8325     K+-transporting ATPase, B subunit
cmr|SACOL2067 Staphylococcus aureus subsp. aureus COL     K+-transporting ATPase, B subunit
dbj|BAF68253.1 Staphylococcus aureus subsp. aureus str. Newman     K+-transporting ATPase, B subunit
fig|426430.6.peg.1928 Staphylococcus aureus subsp. aureus str. Newman FIG   Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)
fig|426430.8.peg.2168 Staphylococcus aureus subsp. aureus str. Newman FIG   Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)
fig|451515.3.peg.2172 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)
fig|451516.9.peg.2161 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)
fig|452948.4.peg.1667 Staphylococcus aureus 930918-3 FIG   Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)
fig|455227.3.peg.1302 Staphylococcus aureus D30 FIG   Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)
fig|546342.3.peg.298 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)
fig|546343.3.peg.1635 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)
fig|553590.4.peg.2609 Staphylococcus aureus A9754 FIG   Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)
fig|644279.4.peg.2220 Staphylococcus aureus subsp. aureus 132 FIG   Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)
fig|93062.19.peg.2015 Staphylococcus aureus subsp. aureus COL FIG   Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)
fig|93062.4.peg.2047 Staphylococcus aureus subsp. aureus COL FIG   Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)
gb|AAW37029.1 Staphylococcus aureus subsp. aureus COL     K+-transporting ATPase, B subunit
gb|ABX30068.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     P-ATPase superfamily P-type ATPase potassium (K+) transporter subunit B
gb|EEV82016.1 Staphylococcus aureus A5948     potassium-transporting ATPase subunit B
gi|150374993 Staphylococcus aureus subsp. aureus str. Newman NCBI   K+-transporting ATPase, B subunit
gi|151222193 Staphylococcus aureus subsp. aureus str. Newman NCBI   potassium-transporting ATPase subunit B
gi|160369097 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   P-ATPase superfamily P-type ATPase potassium (K+) transporter subunit B
gi|161510288 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   P-ATPase superfamily P-type ATPase potassium (K+) transporter subunit B
gi|172048978 potassium-transporting NCBI   RecName: Full=Potassium-transporting ATPase B chain; AltName: Full=Potassium-translocating ATPase B chain; AltName: Full=ATP phosphohydrolase
gi|189081273 potassium-transporting NCBI   RecName: Full=Potassium-transporting ATPase B chain; AltName: Full=Potassium-translocating ATPase B chain; AltName: Full=ATP phosphohydrolase
gi|221137308 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   P-ATPase superfamily P-type ATPase potassium (K+) transporter subunit B
gi|221141598 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   P-ATPase superfamily P-type ATPase potassium (K+) transporter subunit B
gi|257859159 Staphylococcus aureus A5948 NCBI   potassium-transporting ATPase subunit B
gi|258453213 Staphylococcus aureus A5948 NCBI   potassium-transporting ATPase subunit B
gi|57284935 Staphylococcus aureus subsp. aureus COL NCBI   K+-transporting ATPase, B subunit
gi|57650749 Staphylococcus aureus subsp. aureus COL NCBI   K+-transporting ATPase, B subunit
gi|81694082 potassium-transporting NCBI   RecName: Full=Potassium-transporting ATPase B chain; AltName: Full=Potassium-translocating ATPase B chain; AltName: Full=ATP phosphohydrolase
img|637152827 Staphylococcus aureus aureus COL IMG   K+-transporting ATPase, B subunit( EC:3.6.3.12 )
img|640796403 Staphylococcus aureus aureus Newman IMG   K+-transporting ATPase, B subunit
img|641310073 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   P-ATPase superfamily P-type ATPase potassium (K+) transporter subunit B( EC:3.6.3.12 )
img|641771697 Staphylococcus aureus aureus USA300_TCH959 IMG   P-ATPase superfamily P-type ATPase potassium (K+) transporter subunit B
kegg|sac:SACOL2067 Staphylococcus aureus subsp. aureus COL KEGG   potassium-transporting ATPase subunit B (EC:3.6.3.12)
kegg|sae:NWMN_1981 Staphylococcus aureus subsp. aureus Newman KEGG   potassium-transporting ATPase subunit B
kegg|sax:USA300HOU_2071 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   potassium-transporting ATPase subunit B (EC:3.6.3.12)
ref|YP_001333015.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   potassium-transporting ATPase subunit B
ref|YP_001575947.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   P-ATPase superfamily P-type ATPase potassium (K+) transporter subunit B
ref|YP_186883.1 Staphylococcus aureus subsp. aureus COL RefSeq   K+-transporting ATPase, B subunit
ref|ZP_03562117.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   P-ATPase superfamily P-type ATPase potassium (K+) transporter subunit B
ref|ZP_03566091.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   P-ATPase superfamily P-type ATPase potassium (K+) transporter subunit B
ref|ZP_05701204.1 Staphylococcus aureus A5948 RefSeq   potassium-transporting ATPase subunit B
sp|A6QIS1 Staphylococcus aureus (strain Newman) SwissProt   Potassium-transporting ATPase B chain
sp|A8Z4X9 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   Potassium-transporting ATPase B chain
sp|ATKB_STAAC potassium-transporting SwissProt   RecName: Full=Potassium-transporting ATPase B chain; AltName: Full=Potassium-translocating ATPase B chain; AltName: Full=ATP phosphohydrolase
sp|ATKB_STAAE potassium-transporting SwissProt   RecName: Full=Potassium-transporting ATPase B chain; AltName: Full=Potassium-translocating ATPase B chain; AltName: Full=ATP phosphohydrolase
sp|ATKB_STAAT potassium-transporting SwissProt   RecName: Full=Potassium-transporting ATPase B chain; AltName: Full=Potassium-translocating ATPase B chain; AltName: Full=ATP phosphohydrolase
sp|Q5HEC4 Staphylococcus aureus (strain COL) SwissProt   Potassium-transporting ATPase B chain


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
48 fig|93061.5.peg.2094 K+-transporting ATPase chain C (EC 7.2.2.6)
47 fig|93061.5.peg.2096 Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)
47 fig|93061.5.peg.2097 Osmosensitive K+ channel KdpD, turgor pressure sensor / Osmosensitive K+ channel KdpD, histidine kinase
21 fig|93061.5.peg.2098 DNA-binding response regulator KdpE


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search