The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.2042: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: FIG01108895: hypothetical protein
Translate Function Assignments



Context on contig NC_007795 from base 2079816 to 2090938 (11123 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2038 2080661 2079816 846 -           FIG01107971: hypothetical protein locus|SAOUHSC_02245, protein_id|YP_500728.1, gi|88195917, geneID|3919666
2039 2081634 2080723 912 - 61         Ferrichrome-binding periplasmic protein precursor (TC 3.A.1.14.3) locus|SAOUHSC_02246, protein_id|YP_500729.1, gi|88195918, geneID|3919667
2040 2081795 2083102 1308 + 160         KtrAB potassium uptake system, integral membrane component KtrB locus|SAOUHSC_02247, protein_id|YP_500730.1, gi|88195919, geneID|3919668
2041 2084398 2083955 444 - 852     1: 4   Acetyltransferase, GNAT family locus|SAOUHSC_02248, protein_id|YP_500731.1, gi|88195920, geneID|3919669
2042 2084905 2084504 402 - 105         FIG01108895: hypothetical protein locus|SAOUHSC_02249, protein_id|YP_500732.1, gi|88195921, geneID|3919670
2043 2085849 2085259 591 - 353         Phage terminase small subunit locus|SAOUHSC_02250, protein_id|YP_500733.1, gi|88195922, geneID|3919671
2044 2086061 2085846 216 - -4     1: 1   Hypothetical SAV0799 homolog in superantigen-encoding pathogenicity islands SaPI locus|SAOUHSC_02251, protein_id|YP_500734.1, gi|88195923, geneID|3919672
2045 2086191 2086538 348 + 129     1: 1   Degenerate integrase, superantigen-encoding pathogenicity islands SaPI locus|SAOUHSC_02252, protein_id|YP_500735.1, gi|88195924, geneID|3919673
2046 2086399 2086665 267 + -140     1: 1   Degenerate integrase, superantigen-encoding pathogenicity islands SaPI  
2047 2088376 2086760 1617 - 94     4: 1 5 3 2   Heat shock protein 60 family chaperone GroEL gene_name|groEL, locus|SAOUHSC_02254, protein_id|YP_500736.1, gi|88195925, geneID|3919674
2048 2088736 2088452 285 - 75     1: 2 dlit(7916607) Heat shock protein 10 kDa family chaperone GroES gene_name|groES, locus|SAOUHSC_02255, protein_id|YP_500737.1, gi|88195926, geneID|3919675
2049 2088911 2089654 744 + 174         Hypothetical protein SAV2031 locus|SAOUHSC_02256, protein_id|YP_500738.1, gi|88195927, geneID|3919676
2050 2090938 2089679 1260 - 24         Membrane anchored protein locus|SAOUHSC_02257, protein_id|YP_500739.1, gi|88195928, geneID|3919677

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.2042 FIG01108895: hypothetical protein
MGNKQCISLNLLLSDDTFAVISVMTTLGTAILGGIAPSIYGIFTSPIDKKSSFRAISDWE
QEQRNNVKDLMMLLPFTLLSILIVIFIFQFAYSKLFNTIAIIIFIIILVVMFFLILLICY
KITVKICRYFSKE

MD5 = 9655742e09556e3b1bb0ee74cfd388ad


  DNA Sequence

>fig|93061.5.peg.2042 FIG01108895: hypothetical protein
atgggtaataaacaatgcattagtttgaatttattgctttcggatgatactttcgcagta
atttcagtaatgacaactttgggaactgctattttaggaggtatagcaccttcaatatat
ggtatttttacatcgcctatagataaaaaaagtagttttagggctattagcgattgggag
caagaacaaagaaataatgttaaagatctgatgatgctattaccatttacattacttagt
attttaattgtgatttttatttttcagtttgcatattctaaactatttaatacgatagct
attataatatttattataatacttgttgttatgttttttttaattttattaatctgttat
aaaattactgtgaagatatgcagatatttttcaaaagaatag


  DNA with Flanking Sequence

>fig|93061.5.peg.2042 FIG01108895: hypothetical protein
cctatattcattaatattggtgaatgggacggaggtgatgaggggttagataaggcagtg
aaagatgtatctaacgataatcctaatcatactgtgattgtggatgatataccgttagaa
gattatgagtcaattaggtttttataaattgggtatatattttatggtgttgccagtatt
tattgatagtatcggttaagacgatgagaagaatgagtgagatttaaaagagttgtaaac
gcaatatcctaatactgattttcatattgatgatttagggaggttttcaggagtaaaagt
atgatatttttttcaaattacatcaacatttcagattgattattgtaatatataataaaa
tgatttaagaaaaagggagaaaaatggataatataaataaaaatgaaaaatttcgtgttt
tgtaaacaattgctattactatatcatttattttaaattttgggttgtttatttctctag
ctatttggtcaataaattcgatgggtaataaacaatgcattagtttgaatttattgcttt
cggatgatactttcgcagtaatttcagtaatgacaactttgggaactgctattttaggag
gtatagcaccttcaatatatggtatttttacatcgcctatagataaaaaaagtagtttta
gggctattagcgattgggagcaagaacaaagaaataatgttaaagatctgatgatgctat
taccatttacattacttagtattttaattgtgatttttatttttcagtttgcatattcta
aactatttaatacgatagctattataatatttattataatacttgttgttatgttttttt
taattttattaatctgttataaaattactgtgaagatatgcagatatttttcaaaagaat
agaaatgatttgtttacgctgagaaacgtcctgatttgcagtgagaaatgattttgcgta
tctattgtatgtaacaataggtacataatatttttagggtgggttatatgagcataatta
caagattgtttaataacagtgattttgaaaaattaaatcaactatgtaaattatatgatg
atctaggttatccaacaaatgagaatgatttaaaaaagagactaaagaaaataacgaatc
atgatgattacttcctactgcttttgataaaagaaaataaaataattggtttaagtggta
tgtgtaaaatgatgttttacgaaaaaaatgcagagtatatgagaatccttgcgtttgtta
tacattctgaatttaggaaaaaaggttatggaaagagattattagctgattctgaagaat
tttctaaacggttgaattgtaaagcaataacactaaatagtggtaatagaaatgaaagac
tatctgcacataaactatatag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA2030 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
fig|426430.8.peg.2116 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01108895: hypothetical protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search