The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.201: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Sorbitol dehydrogenase homologue (EC:1.1.1.14)
Translate Function Assignments



Context on contig NC_007795 from base 232776 to 244974 (12199 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
195 232776 234872 2097 +           Predicted galactitol operon regulator (Transcriptional antiterminator), BglG family / PTS system, mannitol/fructose-specific IIA component (EC 2.7.1.69) locus|SAOUHSC_00213, protein_id|YP_498808.1, gi|88194021, geneID|3920289
196 234857 235324 468 + -16         PTS system, galactitol-specific IIA component (EC 2.7.1.200) locus|SAOUHSC_00214, protein_id|YP_498809.1, gi|88194022, geneID|3920290
197 235347 235625 279 + 22         PTS system, galactitol-specific IIB component (EC 2.7.1.200) locus|SAOUHSC_00215, protein_id|YP_498810.1, gi|88194023, geneID|3920291
198 235852 237111 1260 + 226         PTS system, galactitol-specific IIC component (EC 2.7.1.69) locus|SAOUHSC_00216, protein_id|YP_498811.1, gi|88194024, geneID|3920292
199 237129 238184 1056 + 17         Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251) locus|SAOUHSC_00217, protein_id|YP_498812.1, gi|88194025, geneID|3920293
200 238186 238332 147 + 1         FIG01108598: hypothetical protein locus|SAOUHSC_00218, protein_id|YP_498813.1, gi|88194026, geneID|3920294
201 238356 239399 1044 + 23         Sorbitol dehydrogenase homologue (EC:1.1.1.14) locus|SAOUHSC_00219, protein_id|YP_498814.1, gi|88194027, geneID|3920295
202 239927 240643 717 + 527     3: 1 2 3   Sugar-phosphate cytidylyltransferase locus|SAOUHSC_00220, protein_id|YP_498815.1, gi|88194028, geneID|3920296
203 240636 241661 1026 + -8         Xylitol dehydrogenase locus|SAOUHSC_00221, protein_id|YP_498816.1, gi|88194029, geneID|3920297
204 241683 243377 1695 + 21     1: 1   Putative polyribitolphosphotransferase locus|SAOUHSC_00222, protein_id|YP_498818.1, gi|88194030, geneID|3920298
205 243805 244974 1170 + 427     1: 1   CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase locus|SAOUHSC_00223, protein_id|YP_498819.1, gi|88194031, geneID|3920299

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.201 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
MKALKLYGVEDLRYEDNEKPVIESANDVIIKVRATGICGSDTSRYKKMGPYIKGMPFGHE
FSGVVDAIGSDVTHVNVGDKVTGCPAIPCYQCEYCLKGEYARCEKLFVIGSYEPGSFAEY
VKLPAQNVLKVPDNVDYIEAAMVEPSAVVAHGFYKSNIQPGMTVAVMGCGSIGLLAIQWA
RIFGAAHIIAIDIDAHKLDIATSLGAHQTINSKEENLEKFIENHYANQIDLAIESSGAKV
TIGQILTLPKKGGEVVLLGIPYDDIEIDRVHFEKILRNELTVCGSWNCLSSNFPGKEWTA
TLHYMKTKDINVKPIISHFLPLEKGPETFDKLVNKKERFDKVMFTIY

MD5 = c3d1a115ba2106b650cbf127608a3787


  DNA Sequence

>fig|93061.5.peg.201 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
gtgaaagcattgaaattatatggcgtggaagatttacggtatgaggataatgaaaagcca
gtcattgaaagtgcgaatgacgttattattaaagtacgagcgactggcatatgtggttca
gacacgtcacgatacaaaaaaatggggccatacattaaaggtatgccatttggtcatgaa
ttttcaggtgtagtagatgccattggaagtgatgttacgcatgttaatgtgggcgacaaa
gtgacaggttgcccagcaataccttgttatcaatgcgagtattgtttaaaaggtgaatat
gcacgatgtgaaaagttattcgtcattggctcatatgaacctggatcgttcgcggaatat
gtcaaattgccagcgcaaaatgttttaaaggttccagacaatgttgattacattgaagca
gcaatggttgagccatcagccgttgttgcgcatgggttttataaatcgaatatacaacct
ggtatgactgttgcagtaatggggtgtggcagtataggtttgttagctattcaatgggca
cgaatatttggtgctgcacatatcatcgctatagatatagatgcgcataaactagatatt
gcaacatcattgggcgcacatcaaacaatcaattcaaaagaagaaaatcttgagaaattc
atcgaaaatcattacgccaatcaaatcgatttagctatagaatcatcaggtgctaaagtt
acgattggtcaaatattgacgctacctaaaaaaggtggcgaggtggtattactcggaata
ccatatgatgatattgagattgatcgcgttcattttgaaaaaattctgcgtaacgagttg
acagtatgtggctcttggaactgtttgtccagtaattttccgggcaaagagtggacggca
accttacattatatgaagacgaaagatattaatgtaaagcctattatttctcatttttta
ccgttagaaaaaggcccggagacatttgataaattagttaacaagaaagaacgatttgat
aaagtcatgtttacgatttattag


  DNA with Flanking Sequence

>fig|93061.5.peg.201 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
ttccagcagcacgacaaggtttggatattttacgcaaaaaaggtttctacagtcaaatag
gtatttttaaggatgctgaaattccatttgatatggaaaaagtgattcaaaaagaaataa
cagttgttggtagtagaagtcaaaagccagcagattgggaaccttcattgcaacttatgg
cggatggtttagtaaatgctgaagctttggtgacaaaaatatatgatatttcgaaatggg
acgaggcgtatcaacatttaaaatccggcgaaggtattaaagcattacttaagccgctcg
atttagatgaaaatgaaggagagaattaatatggtagaatcaatgctaacttttatgctt
gggccattaagacaaatcactgatttttatatggaacatttactcgtaagtaattccatt
gtcattgcaggttattttgcgacaggtatttttaaaaagaaaaaagttgtgaattaaatc
aaatttgaggtgatttacaagtgaaagcattgaaattatatggcgtggaagatttacggt
atgaggataatgaaaagccagtcattgaaagtgcgaatgacgttattattaaagtacgag
cgactggcatatgtggttcagacacgtcacgatacaaaaaaatggggccatacattaaag
gtatgccatttggtcatgaattttcaggtgtagtagatgccattggaagtgatgttacgc
atgttaatgtgggcgacaaagtgacaggttgcccagcaataccttgttatcaatgcgagt
attgtttaaaaggtgaatatgcacgatgtgaaaagttattcgtcattggctcatatgaac
ctggatcgttcgcggaatatgtcaaattgccagcgcaaaatgttttaaaggttccagaca
atgttgattacattgaagcagcaatggttgagccatcagccgttgttgcgcatgggtttt
ataaatcgaatatacaacctggtatgactgttgcagtaatggggtgtggcagtataggtt
tgttagctattcaatgggcacgaatatttggtgctgcacatatcatcgctatagatatag
atgcgcataaactagatattgcaacatcattgggcgcacatcaaacaatcaattcaaaag
aagaaaatcttgagaaattcatcgaaaatcattacgccaatcaaatcgatttagctatag
aatcatcaggtgctaaagttacgattggtcaaatattgacgctacctaaaaaaggtggcg
aggtggtattactcggaataccatatgatgatattgagattgatcgcgttcattttgaaa
aaattctgcgtaacgagttgacagtatgtggctcttggaactgtttgtccagtaattttc
cgggcaaagagtggacggcaaccttacattatatgaagacgaaagatattaatgtaaagc
ctattatttctcattttttaccgttagaaaaaggcccggagacatttgataaattagtta
acaagaaagaacgatttgataaagtcatgtttacgatttattagtatgcacctttgagga
cgaaaacgctggtatagttatagctatgaaagtgcgaatgccgtctggtctatagatact
atcgaaataattcatcttcgaatatacgttgataaatagccggtttacttgtgtgaaata
tgcttgtgaatcggttgttttgcattttgtatacttaaaatgagatggcaatatttgata
atttttaaagtgaaaatcaagtacagccacttaataagataaatttattataatatatgg
taaaatgatggcagtaataatgaatttgaaaaagagtaaacattaatacctttaacaatt
taatatcgtcagagttaatgattaactgcatggcaaaacaacttagaatggtcagttaca
aaaatacatttttataaaaaattatcacactattgtgacaactatctttggattaataaa
agaggcaagtgagcaataggttaggcttatgtgcgggcataggtcagtaatgtataaatg
gaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0008270       F:zinc ion binding
GO:0016491       F:oxidoreductase activity
GO:0055114       P:oxidation reduction
cmr|NT05SA0194 Staphylococcus aureus NCTC 8325     hexitol dehydrogenase
cmr|SACOL0235 Staphylococcus aureus subsp. aureus COL     hexitol dehydrogenase
cmr|SAUSA300_0244 Staphylococcus aureus subsp. aureus USA300-FPR3757     oxidoreductase, zinc-binding dehydrogenase family
dbj|BAF66456.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.2018 Staphylococcus aureus subsp. aureus USA300 FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|426430.6.peg.184 Staphylococcus aureus subsp. aureus str. Newman FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|426430.8.peg.198 Staphylococcus aureus subsp. aureus str. Newman FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|451515.3.peg.305 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|451516.9.peg.295 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|452948.4.peg.98 Staphylococcus aureus 930918-3 FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|455227.3.peg.261 Staphylococcus aureus D30 FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|553567.3.peg.1172 Staphylococcus aureus A5948 FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|553590.4.peg.1248 Staphylococcus aureus A9754 FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|644279.4.peg.316 Staphylococcus aureus subsp. aureus 132 FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|93061.3.peg.228 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|93062.19.peg.229 Staphylococcus aureus subsp. aureus COL FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|93062.4.peg.698 Staphylococcus aureus subsp. aureus COL FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
gb|AAW38790.1 Staphylococcus aureus subsp. aureus COL     hexitol dehydrogenase
gb|ABD22253.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     oxidoreductase, zinc-binding dehydrogenase family
gb|ABD29395.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX28292.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     zinc (Zn2+)-binding dehydrogenase
gb|EEV83550.1 Staphylococcus aureus A5948     zinc-binding dehydrogenase family oxidoreductase
gb|EEW46022.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0681
gb|EEW48191.1 Staphylococcus aureus D30     hypothetical protein SAD30_1746
gi|150373196 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151220396 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0184
gi|160367321 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   zinc (Zn2+)-binding dehydrogenase
gi|161508512 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   zinc (Zn2+)-binding dehydrogenase
gi|257860728 Staphylococcus aureus A5948 NCBI   zinc-binding dehydrogenase family oxidoreductase
gi|258451680 Staphylococcus aureus A5948 NCBI   zinc-binding dehydrogenase family oxidoreductase
gi|259161003 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0681
gi|259163635 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1746
gi|57286696 Staphylococcus aureus subsp. aureus COL NCBI   hexitol dehydrogenase
gi|57652510 Staphylococcus aureus subsp. aureus COL NCBI   hexitol dehydrogenase
gi|87127739 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   oxidoreductase, zinc-binding dehydrogenase family
gi|87161765 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   zinc-binding dehydrogenase family oxidoreductase
gi|87201585 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194027 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00219
img|637151014 Staphylococcus aureus aureus COL IMG   hexitol dehydrogenase
img|637886899 Staphylococcus aureus aureus USA300 IMG   oxidoreductase, zinc-binding dehydrogenase family
img|637892888 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640794544 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641308220 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   zinc (Zn2+)-binding dehydrogenase( EC:1.1.1.- )
img|641771965 Staphylococcus aureus aureus USA300_TCH959 IMG   zinc (Zn2+)-binding dehydrogenase
kegg|saa:SAUSA300_0244 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   zinc-binding dehydrogenase family oxidoreductase
kegg|sac:SACOL0235 Staphylococcus aureus subsp. aureus COL KEGG   hexitol dehydrogenase
kegg|sae:NWMN_0184 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_00219 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_0261 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   zinc (Zn2+)-binding dehydrogenase (EC:1.1.1.-)
ref|YP_001331219.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0184
ref|YP_001574171.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   zinc (Zn2+)-binding dehydrogenase
ref|YP_185131.1 Staphylococcus aureus subsp. aureus COL RefSeq   hexitol dehydrogenase
ref|YP_492958.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   zinc-binding dehydrogenase family oxidoreductase
ref|YP_498814.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00219
ref|ZP_05699706.1 Staphylococcus aureus A5948 RefSeq   zinc-binding dehydrogenase family oxidoreductase
tr|A6QDM4 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z0L3 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Zinc (Zn2+)-binding dehydrogenase
tr|Q2FK20 Staphylococcus aureus (strain USA300) TrEMBL   Oxidoreductase, zinc-binding dehydrogenase family
tr|Q2G2C5 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HJC6 Staphylococcus aureus (strain COL) TrEMBL   Hexitol dehydrogenase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search