The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.201: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Sorbitol dehydrogenase homologue (EC:1.1.1.14)
Translate Function Assignments



Context on contig NC_007795 from base 232776 to 244974 (12199 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
195 232776 234872 2097 +           Predicted galactitol operon regulator (Transcriptional antiterminator), BglG family / PTS system, mannitol/fructose-specific IIA component (EC 2.7.1.69) locus|SAOUHSC_00213, protein_id|YP_498808.1, gi|88194021, geneID|3920289
196 234857 235324 468 + -16 5     PTS system, galactitol-specific IIA component (EC 2.7.1.200) locus|SAOUHSC_00214, protein_id|YP_498809.1, gi|88194022, geneID|3920290
197 235347 235625 279 + 22 6     PTS system, galactitol-specific IIB component (EC 2.7.1.200) locus|SAOUHSC_00215, protein_id|YP_498810.1, gi|88194023, geneID|3920291
198 235852 237111 1260 + 226 7     PTS system, galactitol-specific IIC component (EC 2.7.1.69) locus|SAOUHSC_00216, protein_id|YP_498811.1, gi|88194024, geneID|3920292
199 237129 238184 1056 + 17 5     Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251) locus|SAOUHSC_00217, protein_id|YP_498812.1, gi|88194025, geneID|3920293
200 238186 238332 147 + 1         FIG01108598: hypothetical protein locus|SAOUHSC_00218, protein_id|YP_498813.1, gi|88194026, geneID|3920294
201 238356 239399 1044 + 23       Sorbitol dehydrogenase homologue (EC:1.1.1.14) locus|SAOUHSC_00219, protein_id|YP_498814.1, gi|88194027, geneID|3920295
202 239927 240643 717 + 527     3: 1 2 3   Sugar-phosphate cytidylyltransferase locus|SAOUHSC_00220, protein_id|YP_498815.1, gi|88194028, geneID|3920296
203 240636 241661 1026 + -8         Xylitol dehydrogenase locus|SAOUHSC_00221, protein_id|YP_498816.1, gi|88194029, geneID|3920297
204 241683 243377 1695 + 21     1: 1   Putative polyribitolphosphotransferase locus|SAOUHSC_00222, protein_id|YP_498818.1, gi|88194030, geneID|3920298
205 243805 244974 1170 + 427     1: 1   CDP-ribitol:poly(ribitol phosphate) ribitol phosphotransferase locus|SAOUHSC_00223, protein_id|YP_498819.1, gi|88194031, geneID|3920299

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.201 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
MKALKLYGVEDLRYEDNEKPVIESANDVIIKVRATGICGSDTSRYKKMGPYIKGMPFGHE
FSGVVDAIGSDVTHVNVGDKVTGCPAIPCYQCEYCLKGEYARCEKLFVIGSYEPGSFAEY
VKLPAQNVLKVPDNVDYIEAAMVEPSAVVAHGFYKSNIQPGMTVAVMGCGSIGLLAIQWA
RIFGAAHIIAIDIDAHKLDIATSLGAHQTINSKEENLEKFIENHYANQIDLAIESSGAKV
TIGQILTLPKKGGEVVLLGIPYDDIEIDRVHFEKILRNELTVCGSWNCLSSNFPGKEWTA
TLHYMKTKDINVKPIISHFLPLEKGPETFDKLVNKKERFDKVMFTIY

MD5 = c3d1a115ba2106b650cbf127608a3787


  DNA Sequence

>fig|93061.5.peg.201 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
gtgaaagcattgaaattatatggcgtggaagatttacggtatgaggataatgaaaagcca
gtcattgaaagtgcgaatgacgttattattaaagtacgagcgactggcatatgtggttca
gacacgtcacgatacaaaaaaatggggccatacattaaaggtatgccatttggtcatgaa
ttttcaggtgtagtagatgccattggaagtgatgttacgcatgttaatgtgggcgacaaa
gtgacaggttgcccagcaataccttgttatcaatgcgagtattgtttaaaaggtgaatat
gcacgatgtgaaaagttattcgtcattggctcatatgaacctggatcgttcgcggaatat
gtcaaattgccagcgcaaaatgttttaaaggttccagacaatgttgattacattgaagca
gcaatggttgagccatcagccgttgttgcgcatgggttttataaatcgaatatacaacct
ggtatgactgttgcagtaatggggtgtggcagtataggtttgttagctattcaatgggca
cgaatatttggtgctgcacatatcatcgctatagatatagatgcgcataaactagatatt
gcaacatcattgggcgcacatcaaacaatcaattcaaaagaagaaaatcttgagaaattc
atcgaaaatcattacgccaatcaaatcgatttagctatagaatcatcaggtgctaaagtt
acgattggtcaaatattgacgctacctaaaaaaggtggcgaggtggtattactcggaata
ccatatgatgatattgagattgatcgcgttcattttgaaaaaattctgcgtaacgagttg
acagtatgtggctcttggaactgtttgtccagtaattttccgggcaaagagtggacggca
accttacattatatgaagacgaaagatattaatgtaaagcctattatttctcatttttta
ccgttagaaaaaggcccggagacatttgataaattagttaacaagaaagaacgatttgat
aaagtcatgtttacgatttattag


  DNA with Flanking Sequence

>fig|93061.5.peg.201 Sorbitol dehydrogenase homologue (EC:1.1.1.14)
ttccagcagcacgacaaggtttggatattttacgcaaaaaaggtttctacagtcaaatag
gtatttttaaggatgctgaaattccatttgatatggaaaaagtgattcaaaaagaaataa
cagttgttggtagtagaagtcaaaagccagcagattgggaaccttcattgcaacttatgg
cggatggtttagtaaatgctgaagctttggtgacaaaaatatatgatatttcgaaatggg
acgaggcgtatcaacatttaaaatccggcgaaggtattaaagcattacttaagccgctcg
atttagatgaaaatgaaggagagaattaatatggtagaatcaatgctaacttttatgctt
gggccattaagacaaatcactgatttttatatggaacatttactcgtaagtaattccatt
gtcattgcaggttattttgcgacaggtatttttaaaaagaaaaaagttgtgaattaaatc
aaatttgaggtgatttacaagtgaaagcattgaaattatatggcgtggaagatttacggt
atgaggataatgaaaagccagtcattgaaagtgcgaatgacgttattattaaagtacgag
cgactggcatatgtggttcagacacgtcacgatacaaaaaaatggggccatacattaaag
gtatgccatttggtcatgaattttcaggtgtagtagatgccattggaagtgatgttacgc
atgttaatgtgggcgacaaagtgacaggttgcccagcaataccttgttatcaatgcgagt
attgtttaaaaggtgaatatgcacgatgtgaaaagttattcgtcattggctcatatgaac
ctggatcgttcgcggaatatgtcaaattgccagcgcaaaatgttttaaaggttccagaca
atgttgattacattgaagcagcaatggttgagccatcagccgttgttgcgcatgggtttt
ataaatcgaatatacaacctggtatgactgttgcagtaatggggtgtggcagtataggtt
tgttagctattcaatgggcacgaatatttggtgctgcacatatcatcgctatagatatag
atgcgcataaactagatattgcaacatcattgggcgcacatcaaacaatcaattcaaaag
aagaaaatcttgagaaattcatcgaaaatcattacgccaatcaaatcgatttagctatag
aatcatcaggtgctaaagttacgattggtcaaatattgacgctacctaaaaaaggtggcg
aggtggtattactcggaataccatatgatgatattgagattgatcgcgttcattttgaaa
aaattctgcgtaacgagttgacagtatgtggctcttggaactgtttgtccagtaattttc
cgggcaaagagtggacggcaaccttacattatatgaagacgaaagatattaatgtaaagc
ctattatttctcattttttaccgttagaaaaaggcccggagacatttgataaattagtta
acaagaaagaacgatttgataaagtcatgtttacgatttattagtatgcacctttgagga
cgaaaacgctggtatagttatagctatgaaagtgcgaatgccgtctggtctatagatact
atcgaaataattcatcttcgaatatacgttgataaatagccggtttacttgtgtgaaata
tgcttgtgaatcggttgttttgcattttgtatacttaaaatgagatggcaatatttgata
atttttaaagtgaaaatcaagtacagccacttaataagataaatttattataatatatgg
taaaatgatggcagtaataatgaatttgaaaaagagtaaacattaatacctttaacaatt
taatatcgtcagagttaatgattaactgcatggcaaaacaacttagaatggtcagttaca
aaaatacatttttataaaaaattatcacactattgtgacaactatctttggattaataaa
agaggcaagtgagcaataggttaggcttatgtgcgggcataggtcagtaatgtataaatg
gaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0008270       F:zinc ion binding
GO:0016491       F:oxidoreductase activity
GO:0055114       P:oxidation reduction
cmr|NT05SA0194 Staphylococcus aureus NCTC 8325     hexitol dehydrogenase
cmr|SACOL0235 Staphylococcus aureus subsp. aureus COL     hexitol dehydrogenase
cmr|SAUSA300_0244 Staphylococcus aureus subsp. aureus USA300-FPR3757     oxidoreductase, zinc-binding dehydrogenase family
dbj|BAF66456.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|367830.3.peg.2018 Staphylococcus aureus subsp. aureus USA300 FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|426430.6.peg.184 Staphylococcus aureus subsp. aureus str. Newman FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|426430.8.peg.198 Staphylococcus aureus subsp. aureus str. Newman FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|451515.3.peg.305 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|451516.9.peg.295 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|452948.4.peg.98 Staphylococcus aureus 930918-3 FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|455227.3.peg.261 Staphylococcus aureus D30 FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|553567.3.peg.1172 Staphylococcus aureus A5948 FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|553590.4.peg.1248 Staphylococcus aureus A9754 FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|644279.4.peg.316 Staphylococcus aureus subsp. aureus 132 FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|93061.3.peg.228 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|93062.19.peg.229 Staphylococcus aureus subsp. aureus COL FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
fig|93062.4.peg.698 Staphylococcus aureus subsp. aureus COL FIG   Sorbitol dehydrogenase homologue (EC:1.1.1.14)
gb|AAW38790.1 Staphylococcus aureus subsp. aureus COL     hexitol dehydrogenase
gb|ABD22253.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     oxidoreductase, zinc-binding dehydrogenase family
gb|ABD29395.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX28292.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     zinc (Zn2+)-binding dehydrogenase
gb|EEV83550.1 Staphylococcus aureus A5948     zinc-binding dehydrogenase family oxidoreductase
gb|EEW46022.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0681
gb|EEW48191.1 Staphylococcus aureus D30     hypothetical protein SAD30_1746
gi|150373196 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151220396 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0184
gi|160367321 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   zinc (Zn2+)-binding dehydrogenase
gi|161508512 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   zinc (Zn2+)-binding dehydrogenase
gi|257860728 Staphylococcus aureus A5948 NCBI   zinc-binding dehydrogenase family oxidoreductase
gi|258451680 Staphylococcus aureus A5948 NCBI   zinc-binding dehydrogenase family oxidoreductase
gi|259161003 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0681
gi|259163635 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1746
gi|57286696 Staphylococcus aureus subsp. aureus COL NCBI   hexitol dehydrogenase
gi|57652510 Staphylococcus aureus subsp. aureus COL NCBI   hexitol dehydrogenase
gi|87127739 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   oxidoreductase, zinc-binding dehydrogenase family
gi|87161765 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   zinc-binding dehydrogenase family oxidoreductase
gi|87201585 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194027 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00219
img|637151014 Staphylococcus aureus aureus COL IMG   hexitol dehydrogenase
img|637886899 Staphylococcus aureus aureus USA300 IMG   oxidoreductase, zinc-binding dehydrogenase family
img|637892888 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640794544 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641308220 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   zinc (Zn2+)-binding dehydrogenase( EC:1.1.1.- )
img|641771965 Staphylococcus aureus aureus USA300_TCH959 IMG   zinc (Zn2+)-binding dehydrogenase
kegg|saa:SAUSA300_0244 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   zinc-binding dehydrogenase family oxidoreductase
kegg|sac:SACOL0235 Staphylococcus aureus subsp. aureus COL KEGG   hexitol dehydrogenase
kegg|sae:NWMN_0184 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_00219 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_0261 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   zinc (Zn2+)-binding dehydrogenase (EC:1.1.1.-)
ref|YP_001331219.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0184
ref|YP_001574171.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   zinc (Zn2+)-binding dehydrogenase
ref|YP_185131.1 Staphylococcus aureus subsp. aureus COL RefSeq   hexitol dehydrogenase
ref|YP_492958.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   zinc-binding dehydrogenase family oxidoreductase
ref|YP_498814.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00219
ref|ZP_05699706.1 Staphylococcus aureus A5948 RefSeq   zinc-binding dehydrogenase family oxidoreductase
tr|A6QDM4 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A8Z0L3 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Zinc (Zn2+)-binding dehydrogenase
tr|Q2FK20 Staphylococcus aureus (strain USA300) TrEMBL   Oxidoreductase, zinc-binding dehydrogenase family
tr|Q2G2C5 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HJC6 Staphylococcus aureus (strain COL) TrEMBL   Hexitol dehydrogenase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|93061.5.peg.196 PTS system, galactitol-specific IIA component (EC 2.7.1.200)
6 fig|93061.5.peg.197 PTS system, galactitol-specific IIB component (EC 2.7.1.200)
7 fig|93061.5.peg.198 PTS system, galactitol-specific IIC component (EC 2.7.1.69)
5 fig|93061.5.peg.199 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search