The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1895: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage integrase
Translate Function Assignments



Context on contig NC_007795 from base 1960810 to 1972846 (12037 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1885 1961031 1960810 222 -           Phage phi 11 orf10 protein homolog locus|SAOUHSC_02077, protein_id|YP_500570.1, gi|88195761, geneID|3919764
1886 1961494 1961045 450 - 13         Phage phi 11 orf9 protein homolog locus|SAOUHSC_02078, protein_id|YP_500571.1, gi|88195762, geneID|3919765
1887 1961760 1961536 225 - 41         Phage phi 11 orf8 protein homolog locus|SAOUHSC_02079, protein_id|YP_500572.1, gi|88195763, geneID|3919766
1888 1962552 1961761 792 - 0         Phage antirepressor protein locus|SAOUHSC_02080, protein_id|YP_500573.1, gi|88195764, geneID|3919767
1889 1963017 1962709 309 - 156         Phage protein locus|SAOUHSC_02081, protein_id|YP_500574.1, gi|88195765, geneID|3919768
1890 1963250 1963032 219 - 14         Phage transcriptional regulator cro locus|SAOUHSC_02083, protein_id|YP_500575.1, gi|88195766, geneID|3919769
1891 1963392 1964111 720 + 141         Phage repressor protein cI locus|SAOUHSC_02084, protein_id|YP_500576.1, gi|88195767, geneID|3919770
1892 1964181 1964348 168 + 69         Phage protein locus|SAOUHSC_02085, protein_id|YP_500577.1, gi|88195768, geneID|3919771
1893 1964508 1964693 186 + 159         Phage phi 11 orf4 protein homolog locus|SAOUHSC_02086, protein_id|YP_500578.1, gi|88195769, geneID|3919772
1894 1964729 1965634 906 + 35         Phage phi 11 orf3 protein homolog locus|SAOUHSC_02087, protein_id|YP_500579.1, gi|88195770, geneID|3919773
1895 1965883 1966929 1047 + 248         Phage integrase locus|SAOUHSC_02089, protein_id|YP_500581.1, gi|88195772, geneID|3919775
1896 1966974 1968119 1146 + 44     1: 1   Hypothetical protein SAV1877 locus|SAOUHSC_02090, protein_id|YP_500582.1, gi|88195773, geneID|3919776
1897 1968909 1968379 531 - 259     1: 1   Acyl-CoA hydrolase (EC 3.1.2.20) locus|SAOUHSC_02091, protein_id|YP_500583.1, gi|88195774, geneID|3919777
1898 1970246 1968999 1248 - 89     2: 5 1   Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24) locus|SAOUHSC_02092, protein_id|YP_500584.1, gi|88195775, geneID|3919778
1899 1970458 1970258 201 - 11     2: 2 1   Hypothetical protein YfkK locus|SAOUHSC_02093, protein_id|YP_500585.1, gi|88195776, geneID|3921166
1900 1970605 1971069 465 + 146     1: 1 dlit(12193638) Low molecular weight protein tyrosine phosphatase (EC 3.1.3.48) PtpA locus|SAOUHSC_02095, protein_id|YP_500586.1, gi|88195777, geneID|3921167
1901 1971076 1971351 276 + 6     1: 1   Hypothetical protein YfkI locus|SAOUHSC_02096, protein_id|YP_500587.1, gi|88195778, geneID|3921168
1902 1971629 1972846 1218 + 277     4: 3 2 4 1   Ribonuclease BN (EC 3.1.-.-) locus|SAOUHSC_02097, protein_id|YP_500588.1, gi|88195779, geneID|3921169

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1895 Phage integrase
MPVYKDDNTGKWYFSIRYKDVYGNNKRKMKRGFERKKDAKLAESEFIQNVKYGYSDNQPF
EYIFFDRLKNENLSARSIEKRTTEYNTHIKERFGNIPIGKITTTQCTAFRNYLLNDAGLS
VDYARSVWAGFKAVINYAKKHYKLLYDPTLSVTPIPRTKPQAKFITREEFDEKVEQITND
TSRQLTRLLFYSGLRIGEALALQWKDYDKIKGEIDVNKKINLSNRKIEYNLKKESSKGII
PVPNLIREMLKNMYNESSKRYKYFDENYFIFGGLEPIRYVTYSYHFKSVFPNLKIHHLRH
SYASYLINNGVDMYLLMELMRHSNITETIQTYSHLYTDKKHQAMSIFD

MD5 = 0583c9dbea40459cf9384e1474bfc2ae


  DNA Sequence

>fig|93061.5.peg.1895 Phage integrase
atgccagtatataaggatgataatacaggtaaatggtatttttccattagatataaagat
gtatacggtaataacaaacgaaaaatgaagcgtgggtttgaacgtaagaaagatgccaaa
ctagctgaaagcgaatttatacaaaatgttaaatatggatactcggacaatcaacccttt
gaatatatattttttgatcgtttaaaaaatgaaaatctttctgcacgctcaatagaaaag
cgaactacagaatataatactcacataaaagaaaggttcggaaatatccctattggcaaa
atcactactacgcaatgtactgctttcaggaattatttgttaaacgatgcaggtctttct
gttgactatgcacgatctgtgtgggcaggttttaaagcagttatcaattacgccaaaaag
cattacaagctcttatacgaccccacattatcggtaactcctattcccagaacaaaacca
caagctaaatttatcactcgtgaagaatttgatgaaaaagtagaacaaatcacaaatgat
acttctcgtcagctaactagactgttattttattctggtcttagaataggagaagcttta
gctttgcagtggaaagattacgataaaataaaaggcgaaattgacgtaaataagaaaatc
aatttaagtaatagaaaaattgaatataatctaaaaaaagaaagctctaaagggataata
cctgtaccaaatttaattagagagatgcttaaaaacatgtataatgaatcttctaaaaga
tataaatattttgacgaaaactattttatattcgggggtttagaacctattagatacgtt
acttattcgtatcattttaaatctgtattcccgaatctaaaaatacaccatttaagacac
tcgtacgctagctatttaattaataatggtgtagatatgtatttattaatggaattaatg
aggcattctaacattacagaaacaattcaaacgtactctcatttatatactgataaaaaa
catcaagctatgagcatatttgattaa


  DNA with Flanking Sequence

>fig|93061.5.peg.1895 Phage integrase
ttgaacaagtttgataaagatataattaaacaaacacctgattacaagaggaatataaga
acatttttaaacgaaatggaaaacaacgatttaatagaagaacatttaaaacattcagtc
aaagctgctattgaacacagaaactctattatgcatggtattaaaatcgaagagtacaat
tcgataattcaaacattatttgacgaaatagctaagctgtctaatgtatataagtctctt
aataaacagtaagcaaaatcggattcttcattacataccgaatattcatcataaacactg
actgcatcttctaagacattttttaaaattctaatgtcttcattcgttaaaactaattca
ttgaaattatgattgtttttaaatgtcataacatcacctactttttattttattatatca
catttagtacctagtactaaatttcgggtagcccgcctacccttattattttttgccaat
tttgaggagggagaagcaaaatgccagtatataaggatgataatacaggtaaatggtatt
tttccattagatataaagatgtatacggtaataacaaacgaaaaatgaagcgtgggtttg
aacgtaagaaagatgccaaactagctgaaagcgaatttatacaaaatgttaaatatggat
actcggacaatcaaccctttgaatatatattttttgatcgtttaaaaaatgaaaatcttt
ctgcacgctcaatagaaaagcgaactacagaatataatactcacataaaagaaaggttcg
gaaatatccctattggcaaaatcactactacgcaatgtactgctttcaggaattatttgt
taaacgatgcaggtctttctgttgactatgcacgatctgtgtgggcaggttttaaagcag
ttatcaattacgccaaaaagcattacaagctcttatacgaccccacattatcggtaactc
ctattcccagaacaaaaccacaagctaaatttatcactcgtgaagaatttgatgaaaaag
tagaacaaatcacaaatgatacttctcgtcagctaactagactgttattttattctggtc
ttagaataggagaagctttagctttgcagtggaaagattacgataaaataaaaggcgaaa
ttgacgtaaataagaaaatcaatttaagtaatagaaaaattgaatataatctaaaaaaag
aaagctctaaagggataatacctgtaccaaatttaattagagagatgcttaaaaacatgt
ataatgaatcttctaaaagatataaatattttgacgaaaactattttatattcgggggtt
tagaacctattagatacgttacttattcgtatcattttaaatctgtattcccgaatctaa
aaatacaccatttaagacactcgtacgctagctatttaattaataatggtgtagatatgt
atttattaatggaattaatgaggcattctaacattacagaaacaattcaaacgtactctc
atttatatactgataaaaaacatcaagctatgagcatatttgattaaacggtatcaaatt
ggtatcaaataacaattaaggagtttataaaatgcgtaataacaagcctaaaataagtat
tcaaaacgacccatgggaagcatataacgatgttaaagaacatggccaattaactttaag
taacatcgaatttacaactacaaatctttgtaatatgcgttgtagccactgtgcagttgg
ttatactttacaaactgtcgaccccgagcctttagatatggacttaatttatcgtagact
tgatgaaattccaaatctgcgaacgatgtctattacaggtggcgaaccaatgttttctaa
aaagtctattagaaatgttgttaaacctctattaaagtatgcacatcatcgaggtatata
tacacaaatgaattcaaacctaacattgcctcaagatcgttatttagatattgctgaata
tatcgatgttatgcatatctcacacaactggggaacaactgatgaattcgcaaatgttgg
ctttggc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
GO:0006310       P:DNA recombination
GO:0015074       P:DNA integration
cmr|NT05SA1890 Staphylococcus aureus NCTC 8325     integrase
fig|12360.1.peg.1 Staphylococcus aureus phage phi 11 FIG   Phage integrase
fig|93061.3.peg.1973 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage integrase
gb|AAA32198.1 Staphylococcus phage 11     integrase (int)
gb|AAL82229.1 Staphylococcus aureus phage phi 11     integrase
gb|ABD31140.1 Staphylococcus aureus subsp. aureus NCTC 8325     integrase, phage family, putative
gi|166159 Staphylococcus phage 11 NCBI   integrase (int)
gi|18920488 Staphylococcus aureus phage phi 11 NCBI   integrase
gi|29028564 Staphylococcus phage 11 NCBI   integrase
gi|87203330 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   integrase, phage family, putative
gi|88195772 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   phage family integrase
img|637894715 Staphylococcus aureus aureus NCTC 8325 IMG   integrase, phage family, putative
img|638296996 Staphylococcus phage 11 IMG   integrase
kegg|sao:SAOUHSC_02089 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   phage family integrase
ref|NP_803254.1 Staphylococcus phage 11 RefSeq   integrase
ref|YP_500581.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   phage family integrase
tr|Q2FX17 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Integrase, phage family, putative
tr|Q38045 Staphylococcus phage phi11 (Bacteriophage phi-11) TrEMBL   Integrase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search