The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1891: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage repressor protein cI
Translate Function Assignments



Context on contig NC_007795 from base 1958083 to 1970246 (12164 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1879 1958637 1958083 555 -           Phage ssDNA binding protein locus|SAOUHSC_02071, protein_id|YP_500564.1, gi|88195755, geneID|3919758
1880 1959446 1958667 780 - 29         Phage phi 11 orf12 protein homolog locus|SAOUHSC_02072, protein_id|YP_500565.1, gi|88195756, geneID|3919759
1881 1959983 1959447 537 - 0         Phage phi 11 orf61 protein homolog locus|SAOUHSC_02073, protein_id|YP_500566.1, gi|88195757, geneID|3919760
1882 1960256 1959996 261 - 12         Phage phi 11 orf11 protein homolog locus|SAOUHSC_02074, protein_id|YP_500567.1, gi|88195758, geneID|3919761
1883 1960566 1960237 330 - -20         Phage protein locus|SAOUHSC_02075, protein_id|YP_500568.1, gi|88195759, geneID|3919762
1884 1960817 1960656 162 - 89         Phage phi 11 orf10a protein homolog locus|SAOUHSC_02076, protein_id|YP_500569.1, gi|88195760, geneID|3919763
1885 1961031 1960810 222 - -8         Phage phi 11 orf10 protein homolog locus|SAOUHSC_02077, protein_id|YP_500570.1, gi|88195761, geneID|3919764
1886 1961494 1961045 450 - 13         Phage phi 11 orf9 protein homolog locus|SAOUHSC_02078, protein_id|YP_500571.1, gi|88195762, geneID|3919765
1887 1961760 1961536 225 - 41         Phage phi 11 orf8 protein homolog locus|SAOUHSC_02079, protein_id|YP_500572.1, gi|88195763, geneID|3919766
1888 1962552 1961761 792 - 0         Phage antirepressor protein locus|SAOUHSC_02080, protein_id|YP_500573.1, gi|88195764, geneID|3919767
1889 1963017 1962709 309 - 156         Phage protein locus|SAOUHSC_02081, protein_id|YP_500574.1, gi|88195765, geneID|3919768
1890 1963250 1963032 219 - 14         Phage transcriptional regulator cro locus|SAOUHSC_02083, protein_id|YP_500575.1, gi|88195766, geneID|3919769
1891 1963392 1964111 720 + 141         Phage repressor protein cI locus|SAOUHSC_02084, protein_id|YP_500576.1, gi|88195767, geneID|3919770
1892 1964181 1964348 168 + 69         Phage protein locus|SAOUHSC_02085, protein_id|YP_500577.1, gi|88195768, geneID|3919771
1893 1964508 1964693 186 + 159         Phage phi 11 orf4 protein homolog locus|SAOUHSC_02086, protein_id|YP_500578.1, gi|88195769, geneID|3919772
1894 1964729 1965634 906 + 35         Phage phi 11 orf3 protein homolog locus|SAOUHSC_02087, protein_id|YP_500579.1, gi|88195770, geneID|3919773
1895 1965883 1966929 1047 + 248         Phage integrase locus|SAOUHSC_02089, protein_id|YP_500581.1, gi|88195772, geneID|3919775
1896 1966974 1968119 1146 + 44     1: 1   Hypothetical protein SAV1877 locus|SAOUHSC_02090, protein_id|YP_500582.1, gi|88195773, geneID|3919776
1897 1968909 1968379 531 - 259     1: 1   Acyl-CoA hydrolase (EC 3.1.2.20) locus|SAOUHSC_02091, protein_id|YP_500583.1, gi|88195774, geneID|3919777
1898 1970246 1968999 1248 - 89     2: 2 1   Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24) locus|SAOUHSC_02092, protein_id|YP_500584.1, gi|88195775, geneID|3919778

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1891 Phage repressor protein cI
MDKKELAKFIGNKIRYYRTKLNLTQDQLGEKLNTKKATISNYETGYRTPKQDDLFEIAHI
LNISIDDLFPTRNNKKNDITSIYNKLTPPRQENVLNYANEQLDEQNKVTSIDEYKESKLV
SYIACGATGAGIGEELYDDILHEEVFFKEDETPSNADFCILVNGDSMEPMLKQGTYAFIK
KEDSIKDGTIALVVLDGVSLIKRVDICEDYINLVSLNPKYDDIKVASFSNIKVMGKVVL

MD5 = 15da5d447dd5afa1ca4bd44ce3a3e41a


  DNA Sequence

>fig|93061.5.peg.1891 Phage repressor protein cI
atggataaaaaagaattagcgaaatttataggcaataaaatcagatactatagaaccaaa
ttgaacttaactcaagatcaacttggagaaaaactcaacactaaaaaagctactatttca
aattatgagacagggtacagaactcctaaacaagatgatttgtttgaaattgctcatatt
ttaaatatcagtatcgatgatttgtttcctacaagaaataataaaaaaaacgacatcact
tccatatacaacaaactcacacctccccgccaagaaaacgtacttaactacgcaaatgag
caattagatgaacagaataaagtcacttctatagatgaatataaagagtctaaactagta
tcgtatattgcatgtggtgcaactggtgctggcataggagaagaattatatgatgacata
ttgcatgaagaagtattttttaaagaagacgaaacgccatcaaatgctgatttttgtatt
ttagttaatggtgattcaatggaacctatgttaaaacaaggaacatacgcttttattaag
aaagaagattctattaaagatggtacaattgcactcgttgtattagatggagtaagtctt
atcaagcgtgtagatatatgcgaagactatattaatttggtatctctaaatccgaagtat
gatgatatcaaagtcgcttcgtttagtaatattaaagtaatgggcaaagttgtattgtga


  DNA with Flanking Sequence

>fig|93061.5.peg.1891 Phage repressor protein cI
atgtttgttgaaaagatctcgagtgtatcttatttctttaagtgatttatcataagcttc
aatttgtcctgaaaggttatgatattttagttgtagttttactaattttaatgattggtc
ttgcatttgttatgtctcctttaagatgtttgtttgcgtttcgtgtactttgtgggtaaa
aaaatatctccaatattttcgtcaaaaaaatcagcgataataaacatctcatcattctta
aattgatgctttcctaattcttttaaacgataaccttcagttgatatattcaagaggttt
gctaaatcttcttgagtacactttctttcttttctcaactttattaaattccattgcatg
ttgtcacctcccgcttacaaaacctactatacacgatacgtgtacttgagtcaacataaa
agtttgcttttcgtgtatttttttgttgaataccaaaaataattgggttatactataggt
aaatttaaggaggtaagaaaatggataaaaaagaattagcgaaatttataggcaataaaa
tcagatactatagaaccaaattgaacttaactcaagatcaacttggagaaaaactcaaca
ctaaaaaagctactatttcaaattatgagacagggtacagaactcctaaacaagatgatt
tgtttgaaattgctcatattttaaatatcagtatcgatgatttgtttcctacaagaaata
ataaaaaaaacgacatcacttccatatacaacaaactcacacctccccgccaagaaaacg
tacttaactacgcaaatgagcaattagatgaacagaataaagtcacttctatagatgaat
ataaagagtctaaactagtatcgtatattgcatgtggtgcaactggtgctggcataggag
aagaattatatgatgacatattgcatgaagaagtattttttaaagaagacgaaacgccat
caaatgctgatttttgtattttagttaatggtgattcaatggaacctatgttaaaacaag
gaacatacgcttttattaagaaagaagattctattaaagatggtacaattgcactcgttg
tattagatggagtaagtcttatcaagcgtgtagatatatgcgaagactatattaatttgg
tatctctaaatccgaagtatgatgatatcaaagtcgcttcgtttagtaatattaaagtaa
tgggcaaagttgtattgtgattaatagcgcctatatggcactttaatataaaagacgtct
atttcagcagtgtttaaaaggagtttataatgaaaataactaattgcaaaataaaaaaag
aaactatagtatatgaagttttaactagtggtaatcaaccattcacttatgagttaccta
aagatttatcgtcacataatgcgcgtaaatacttggaatttatttcacaaaaaatagatg
gcgataagttaaattaattcaaagaataaagtaacttcataaagagtacgaagaaaacga
tctaatgaccgaacttattcttgaatatttagtaaaaaagtatgttgaagaagaatatag
gaaataagctcctatacggcgctttaacataaaaagtaaaggagaaataaaaaattatgg
aatcatatgaagaaattgagcatatacacattaacactggtagaaaaaaacttacacaag
aacaaatagaagaagccaaagcttttatagacagtcaagg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0043565       F:sequence-specific DNA binding
cmr|NT05SA1886 Staphylococcus aureus NCTC 8325     77ORF011
cmr|SACOL0321 Staphylococcus aureus subsp. aureus COL     prophage L54a, repressor protein, putative
fig|12360.1.peg.5 Staphylococcus aureus phage phi 11 FIG   Phage repressor protein cI
fig|320837.3.peg.42 Bacteriophage 42e FIG   Phage repressor protein cI
fig|93061.3.peg.1968 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage repressor protein cI
fig|93062.19.peg.314 Staphylococcus aureus subsp. aureus COL FIG   Phage repressor protein cI
fig|93062.4.peg.780 Staphylococcus aureus subsp. aureus COL FIG   Phage repressor protein cI
gb|AAL82233.1 Staphylococcus aureus phage phi 11     cI-like repressor
gb|AAW37528.1 Staphylococcus aureus subsp. aureus COL     prophage L54a, repressor protein, putative
gb|AAX91130.1 Bacteriophage 42e     ORF018
gb|ABD31135.1 Staphylococcus aureus subsp. aureus NCTC 8325     phage repressor protein, putative
gi|18920492 Staphylococcus aureus phage phi 11 NCBI   cI-like repressor
gi|29028568 Staphylococcus phage 11 NCBI   cI-like repressor
gi|57285434 Staphylococcus aureus subsp. aureus COL NCBI   prophage L54a, repressor protein, putative
gi|57651248 Staphylococcus aureus subsp. aureus COL NCBI   prophage L54a, repressor protein, putative
gi|62636019 Bacteriophage 42e NCBI   ORF018
gi|66395526 Staphylococcus phage 42E NCBI   ORF018
gi|87203325 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   phage repressor protein, putative
gi|88195767 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   phage repressor protein, putative
img|637151096 Staphylococcus aureus aureus COL IMG   prophage L54a, repressor protein, putative
img|637894710 Staphylococcus aureus aureus NCTC 8325 IMG   phage repressor protein, putative
img|638297000 Staphylococcus phage 11 IMG   cI-like repressor
img|638314313 Bacteriophage 42e IMG   ORF018
kegg|sac:SACOL0321 Staphylococcus aureus subsp. aureus COL KEGG   prophage L54a, repressor protein, putative
kegg|sao:SAOUHSC_02084 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   phage repressor protein, putative
ref|NP_803258.1 Staphylococcus phage 11 RefSeq   cI-like repressor
ref|YP_185213.1 Staphylococcus aureus subsp. aureus COL RefSeq   prophage L54a, repressor protein, putative
ref|YP_239894.1 Staphylococcus phage 42E RefSeq   ORF018
ref|YP_500576.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   phage repressor protein, putative
tr|Q2FX22 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Phage repressor protein, putative
tr|Q4ZCY2 Staphylococcus phage 42E TrEMBL   ORF018
tr|Q5HJ44 Staphylococcus aureus (strain COL) TrEMBL   Prophage L54a, repressor protein, putative
tr|Q8SDX2 Staphylococcus phage phi11 (Bacteriophage phi-11) TrEMBL   CI-like repressor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search