The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1834: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage phi 11 orf51 protein homolog
Translate Function Assignments



Context on contig NC_007795 from base 1921172 to 1932903 (11732 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1827 1921981 1921172 810 -       3: 4 6 1 dlit(7905453) Monofunctional biosynthetic peptidoglycan transglycosylase locus|SAOUHSC_02012, protein_id|YP_500509.1, gi|88195700, geneID|3920466
1828 1922837 1922322 516 - 340     1: 1 dlit(7905453) Intracellular protease locus|SAOUHSC_02013, protein_id|YP_500510.1, gi|88195701, geneID|3920467
1829 1923129 1922968 162 - 130     1: 1   Hypothetical protein FIG009695 locus|SAOUHSC_02014, protein_id|YP_500511.1, gi|88195702, geneID|3920468
1830 1924068 1923883 186 - 753         Phage protein locus|SAOUHSC_02016, protein_id|YP_500513.1, gi|88195704, geneID|3920470
1831 1924379 1924251 129 - 182         FIG01108176: hypothetical protein locus|SAOUHSC_02018, protein_id|YP_500515.1, gi|88195706, geneID|3920472
1832 1926092 1924647 1446 - 267       dlit(17085695) Phage lysin, N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) locus|SAOUHSC_02019, protein_id|YP_500516.1, gi|88195707, geneID|3920473
1833 1926510 1926073 438 - -20         Phage holin locus|SAOUHSC_02020, protein_id|YP_500517.1, gi|88195708, geneID|3920474
1834 1926961 1926566 396 - 55         Phage phi 11 orf51 protein homolog locus|SAOUHSC_02021, protein_id|YP_500518.1, gi|88195709, geneID|3920475
1835 1928139 1926967 1173 - 5     1: 7   Phage phi 11 orf50 protein homolog locus|SAOUHSC_02022, protein_id|YP_500519.1, gi|88195710, geneID|3920476
1836 1930050 1928152 1899 - 12     4: 8 2 3 5   Phage endolysin N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Phage endo-beta-N-acetylglucosaminidase (EC 3.2.1.96) locus|SAOUHSC_02023, protein_id|YP_500520.1, gi|88195711, geneID|3920477
1837 1930486 1930187 300 - 136         Phage phi 11 orf48 protein homolog locus|SAOUHSC_02025, protein_id|YP_500521.1, gi|88195712, geneID|3920478
1838 1930699 1930526 174 - 39         Phage phi 11 orf47 protein homolog locus|SAOUHSC_02026, protein_id|YP_500522.1, gi|88195713, geneID|3920479
1839 1931080 1930703 378 - 3         Phage phi 11 orf46 protein homolog locus|SAOUHSC_02027, protein_id|YP_500523.1, gi|88195714, geneID|3920480
1840 1932903 1931080 1824 - -1         FIG01108548: hypothetical protein locus|SAOUHSC_02028, protein_id|YP_500524.1, gi|88195715, geneID|3920481

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1834 Phage phi 11 orf51 protein homolog
MEGNFKNVKKFIYEGEEYTKVYAGNIQVWKKPSSFVIKPLPKNKYPDSIEESTAKWTING
VEPNKSYQVTIENVRSGIMRISQTNLGSSDLGISGVNSGVASKNINFSNPSGMLYVTISD
VYSGSPTLTIE

MD5 = 5dbc8feba098b24d5258bee1f7e70903


  DNA Sequence

>fig|93061.5.peg.1834 Phage phi 11 orf51 protein homolog
atggaaggtaattttaaaaatgtaaagaagtttatttacgaaggtgaagaatatacaaaa
gtatatgctggaaatatccaagtatggaaaaagccttcatcttttgtaataaaaccctta
cctaaaaataaatatccggatagcatagaagaatcaacagcaaaatggacaataaatgga
gttgaacccaataaaagttatcaggtgacaatagaaaatgtacgtagcggtataatgagg
atttcgcaaactaatttagggtcaagtgatttaggaatatcaggagtcaatagcggagtt
gcaagtaaaaatatcaactttagtaatccttcagggatgttgtacgtcactataagtgat
gtttattcaggatctccgacattgaccattgaataa


  DNA with Flanking Sequence

>fig|93061.5.peg.1834 Phage phi 11 orf51 protein homolog
acagatatcaaagcagaacctgagttattggacaaaatcaatatcgcaaatgttgaaggg
ttagaaaataaattgcaagaagttgaaaaaatcaaagatacaactctcaacgactctaaa
acgtatacggatacaaaaattgctgaactagttgatagcgcgcctgaatctatgaacaca
ttaagagaattagcagaagcaatacaaaacaactctatttcagaaagtgtattgcaacag
attggctcaaaagttaatacagaagattttgaggaattcaaacaaacactaaatgattta
tatgctccaaaaaatcataatcatgacgagcggtatgttttgtcatctcaagcttttact
aaacaacaagcggataatttatatcaactaaaaagcgcatctcaaccgacggttaaaatt
tggacaggaacagaaaatgaatataactatatatatcaaaaagacccgaatacgttatat
ttaattaaagggtgatttttatggaaggtaattttaaaaatgtaaagaagtttatttacg
aaggtgaagaatatacaaaagtatatgctggaaatatccaagtatggaaaaagccttcat
cttttgtaataaaacccttacctaaaaataaatatccggatagcatagaagaatcaacag
caaaatggacaataaatggagttgaacccaataaaagttatcaggtgacaatagaaaatg
tacgtagcggtataatgaggatttcgcaaactaatttagggtcaagtgatttaggaatat
caggagtcaatagcggagttgcaagtaaaaatatcaactttagtaatccttcagggatgt
tgtacgtcactataagtgatgtttattcaggatctccgacattgaccattgaataatttt
aaacgactaatttttagtcgtttttttattttggataaaaggagcaaacaaatggatatt
aactggaaattgagattcaaaaacaaagcagtactaactggtttagttggagcattgttg
ctatttatcaagcaagtcacggatttattcggattagatttatctactcaattaaatcaa
gctagcgcaattataggcgctatcctcacgttacttacaggtattggcgttattactgac
ccaacgtcaaaaggcgtctcagattcatctatagcacagacatatcaagcgcctagagat
agcaaaaaagaagaacaacaagttacgtggaaatcatcacaagacagtagtttaacgccg
gaattaagcgcgaaagcaccaaaagaatatgatacatcacaacctttcacagacgcctct
aacgatgttggctttgatgtgaatgagtatcatcatggaggtggcgacaatgcaagcaaa
attaactaaaaatgag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA1829 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
fig|12360.1.peg.51 Staphylococcus aureus phage phi 11 FIG   Phage phi 11 orf51 protein homolog
fig|585151.3.peg.1500 Staphylococcus aureus subsp. aureus C427 FIG   Phage phi 11 orf51 protein homolog
fig|93061.3.peg.1910 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage phi 11 orf51 protein homolog
gb|AAL82279.1 Staphylococcus aureus phage phi 11     phi ETA orf 63-like protein
gb|ABD31077.1 Staphylococcus aureus subsp. aureus NCTC 8325     phi ETA orf 63-like protein
gi|18920538 Staphylococcus aureus phage phi 11 NCBI   phi ETA orf 63-like protein
gi|29028614 Staphylococcus phage 11 NCBI   phi ETA orf 63-like protein
gi|87203267 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   phi ETA orf 63-like protein
gi|88195709 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   phi ETA orf 63-like protein
img|637894652 Staphylococcus aureus aureus NCTC 8325 IMG   phi ETA orf 63-like protein
img|638297046 Staphylococcus phage 11 IMG   phi ETA orf 63-like protein
kegg|sao:SAOUHSC_02021 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   phi ETA orf 63-like protein
ref|NP_803304.1 Staphylococcus phage 11 RefSeq   phi ETA orf 63-like protein
ref|YP_500518.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   phi ETA orf 63-like protein
tr|Q2FX75 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Phi ETA orf 63-like protein
tr|Q8SDS9 Staphylococcus phage phi11 (Bacteriophage phi-11) TrEMBL   Phi ETA orf 63-like protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search