The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1813: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Mobile element protein
Translate Function Assignments



Context on contig NC_007795 from base 1892067 to 1904457 (12391 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1809 1893194 1892067 1128 -       14: 8 14 3 13 5 2 10 17 1 11 15 16 12 4   tRNA epoxyqueuosine(34) reductase (EC 1.17.99.6) locus|SAOUHSC_01989, protein_id|YP_500486.1, gi|88195680, geneID|3921872
1810 1894073 1893345 729 - 150     1: 7   Arginine ABC transporter, ATP-binding protein locus|SAOUHSC_01990, protein_id|YP_500487.1, gi|88195681, geneID|3921873
1811 1895517 1894060 1458 - -14     1: 6   Arginine ABC transporter, substrate-binding and permease protein locus|SAOUHSC_01991, protein_id|YP_500488.1, gi|88195682, geneID|3921874
1812 1896836 1895775 1062 - 257         Membrane protein locus|SAOUHSC_01992, protein_id|YP_500489.1, gi|88195683, geneID|3921875
1813 1897329 1898531 1203 + 492         Mobile element protein locus|SAOUHSC_01993, protein_id|YP_500490.1, gi|88195684, geneID|3921876
rna.31 1898988 1898905 84 - 373         tRNA-Leu-CAA  
rna.32 1899101 1899027 75 - 38         tRNA-Pseudo-TCC  
rna.33 1899279 1899205 75 - 103         tRNA-Gly-TCC  
rna.34 1899360 1899287 74 - 7         tRNA-Cys-GCA  
rna.35 1899437 1899366 72 - 5         tRNA-Gln-TTG  
rna.36 1899521 1899449 73 - 11         tRNA-His-GTG  
rna.37 1899597 1899524 74 - 2         tRNA-Trp-CCA  
rna.38 1899693 1899613 81 - 15         tRNA-Tyr-GTA  
rna.39 1899774 1899699 76 - 5         tRNA-Thr-TGT  
rna.40 1899854 1899782 73 - 7         tRNA-Phe-GAA  
rna.41 1899948 1899873 76 - 18         tRNA-Asp-GTC  
rna.42 1900031 1899958 74 - 9         tRNA-Met-CAT  
rna.43 1900138 1900046 93 - 14         tRNA-Ser-TGA  
rna.44 1900252 1900177 76 - 38         tRNA-Asp-GTC  
rna.45 1900352 1900263 90 - 10         tRNA-Ser-TGA  
rna.46 1900435 1900362 74 - 9         tRNA-Met-CAT  
rna.47 1900537 1900461 77 - 25         tRNA-Met-CAT  
rna.48 1900634 1900559 76 - 21         tRNA-Ala-TGC  
rna.49 1900725 1900652 74 - 17         tRNA-Pro-TGG  
rna.50 1900808 1900735 74 - 9         tRNA-Arg-ACG  
rna.51 1900915 1900827 89 - 18         tRNA-Leu-TAA  
rna.52 1901000 1900926 75 - 10         tRNA-Gly-GCC  
rna.53 1901085 1901004 82 - 3         tRNA-Leu-TAG  
rna.54 1901164 1901089 76 - 3         tRNA-Lys-TTT  
rna.55 1901245 1901170 76 - 5         tRNA-Thr-TGT  
rna.56 1901337 1901262 76 - 16         tRNA-Val-TAC  
rna.57 1901463 1901349 115 - 11         5S RNA  
rna.58 1904457 1901625 2833 - 161     1: 9   Large Subunit Ribosomal RNA; lsuRNA; LSU rRNA  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1813 Mobile element protein
MCNDTLELLRIKDENIKYINQEIDVIIKGKKATVVNAVLTYKPSACYCCGVKNEGQIHKH
GKRVSRITLLKTQGYNTYLNLAKQRFKCLECNGTFTAKTSIVDESCFISRCVTQKVIEEA
TKVKTEIDTAEDNCISPSTVSRIRTKAANSLRIKPFNCLPEHIAMDEFKSVKNVTGSMSF
IFIDNDTHDVIDILENRTTRFLRAYFERFDLKNRQQVKTVTIDMYEPYVRLFRDLFPNAA
IIFDRFHIVQHLNRELNKYRVQVMNEYRNKKGPDYTIFKNNWKVLLMDTSKTIFSKYRWN
KSFKAYKRSSDIVEFMLSKDDILRHSYELVQGLRKDLRLCNWPKFINRLNSVSKKSVSKG
VWKVVKYYRKHQRMLRNTIYYPAFNNGAIEGINNKIKLIK

MD5 = f54c1d9faa980db5324dfdcdf5482061


  DNA Sequence

>fig|93061.5.peg.1813 Mobile element protein
atgtgtaatgataccttagaattactaagaataaaagatgaaaatataaaatatataaac
caagaaattgacgtcattatcaaaggaaaaaaagcaacagtggttaatgctgtactaacg
tataagccttcggcctgttattgttgtggagttaaaaatgaaggacaaattcataaacat
ggtaagcgtgtttctcgtattactttacttaaaactcaagggtataacacatacctcaac
ttagctaaacaacgttttaaatgcttagaatgcaatggcacttttactgctaaaacgtca
attgttgatgagtcgtgttttatctcaagatgtgttactcaaaaagttatagaagaagct
actaaagttaaaacagagattgatactgcagaagataactgtatctctccatctactgta
agtcgtattagaactaaagcggctaattcattacgaattaaaccctttaattgtttgcca
gaacacatcgctatggatgaatttaaaagcgttaaaaatgtaactggatcaatgagtttc
atttttatagataatgatactcatgatgttatagatattttagaaaatagaactacaaga
ttcttgcgtgcctatttcgagcgattcgatttaaaaaatcgacaacaagttaagacggtt
actattgacatgtatgaaccctatgtccgattatttcgcgacctatttcctaatgcagct
attatttttgacagattccatatcgttcaacatttaaatagagaacttaataagtatcgt
gtacaagttatgaatgaataccgtaataaaaaaggacctgattatacaatttttaagaat
aactggaaagtcctattgatggatactagtaaaaccatatttagtaaatacagatggaat
aaatcttttaaggcttataaacgctcatctgacattgtagaattcatgctttcaaaagac
gatatactacgacactcctacgaacttgtccaaggattacgaaaagacctaaggttatgt
aattggcctaaatttattaatcgtttaaattcagttagtaaaaagtctgtgagtaagggt
gtatggaaagtggttaaatattatagaaaacatcaaaggatgttaagaaatacaatttat
tacccagcatttaataatggtgctatagaaggaattaataataagataaaattaatcaag
tga


  DNA with Flanking Sequence

>fig|93061.5.peg.1813 Mobile element protein
ttactcataaacgacctccaatttgaacattaaactcatcatattatagaaaattaactt
taacaatgattagttggctaatttaatctaaatataacaatccacaaattgaataaagca
aatttaaacaatctactcactaatcaatgtcatgttaattttaaaatactactaattaca
tcctgtgactaataatgtaataaattgtaaatattaaaatagccatattactattaagat
agataaattgaatcgacttggtataaagcacaataaaatagcacttttacaaatatatta
ttagaaaagttgaaacaaatatataaccccagataatataatcattatcattaatgtaat
accaaaaaaagaagttaaacaggttcttcatcttttatggtgggaaggtaaaacttcctg
ctttttttaatacacaaaaagcgcaattgcctctataatttaaagtgaccaaacccaaac
taaaggagacaagtgcgcctatgtgtaatgataccttagaattactaagaataaaagatg
aaaatataaaatatataaaccaagaaattgacgtcattatcaaaggaaaaaaagcaacag
tggttaatgctgtactaacgtataagccttcggcctgttattgttgtggagttaaaaatg
aaggacaaattcataaacatggtaagcgtgtttctcgtattactttacttaaaactcaag
ggtataacacatacctcaacttagctaaacaacgttttaaatgcttagaatgcaatggca
cttttactgctaaaacgtcaattgttgatgagtcgtgttttatctcaagatgtgttactc
aaaaagttatagaagaagctactaaagttaaaacagagattgatactgcagaagataact
gtatctctccatctactgtaagtcgtattagaactaaagcggctaattcattacgaatta
aaccctttaattgtttgccagaacacatcgctatggatgaatttaaaagcgttaaaaatg
taactggatcaatgagtttcatttttatagataatgatactcatgatgttatagatattt
tagaaaatagaactacaagattcttgcgtgcctatttcgagcgattcgatttaaaaaatc
gacaacaagttaagacggttactattgacatgtatgaaccctatgtccgattatttcgcg
acctatttcctaatgcagctattatttttgacagattccatatcgttcaacatttaaata
gagaacttaataagtatcgtgtacaagttatgaatgaataccgtaataaaaaaggacctg
attatacaatttttaagaataactggaaagtcctattgatggatactagtaaaaccatat
ttagtaaatacagatggaataaatcttttaaggcttataaacgctcatctgacattgtag
aattcatgctttcaaaagacgatatactacgacactcctacgaacttgtccaaggattac
gaaaagacctaaggttatgtaattggcctaaatttattaatcgtttaaattcagttagta
aaaagtctgtgagtaagggtgtatggaaagtggttaaatattatagaaaacatcaaagga
tgttaagaaatacaatttattacccagcatttaataatggtgctatagaaggaattaata
ataagataaaattaatcaagtgaatttcttttggttacagaaatttcaacaactttaaag
cacgtataatgatgattttcagcttgtacaaaggagaaaaaaagaagacaaccaagccca
ataatggactggccgcctaataataaaaactctaaaagttgtattttaaaaatagttctt
taaattatatacccaccacatttggtggagaaccgttaaacaatgcatagttgcttaact
tccaatattgaactcatcattacaatttgacatagagtctattaaagcgtgtgccatttg
agtccacttttatttgtattgtatagagagaaataaaaagaaaccttgttttacaaggtt
tctaatacgttatgttatgtaaataacagttaattataccggtggtcggggtcgaaccga
cactccacaagtggaacgggattttgagtcccgcgcgtctgccaattccgccacaccggc
ttaatggtaaacaaaaaacttccctttggaagcaattatggag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
GO:0004803       F:transposase activity
GO:0006313       P:transposition, DNA-mediated
cmr|NT05SA1777 Staphylococcus aureus NCTC 8325     transposase
cmr|NT05SA2171 Staphylococcus aureus NCTC 8325     transposase
fig|426430.6.peg.2007 Staphylococcus aureus subsp. aureus str. Newman FIG   Mobile element protein
fig|426430.8.peg.2252 Staphylococcus aureus subsp. aureus str. Newman FIG   Mobile element protein
fig|451515.3.peg.2258 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Mobile element protein
fig|451516.9.peg.2247 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Mobile element protein
fig|455227.3.peg.2622 Staphylococcus aureus D30 FIG   Mobile element protein
fig|553590.4.peg.2872 Staphylococcus aureus A9754 FIG   Mobile element protein
fig|93061.3.peg.1882 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Mobile element protein
fig|93061.3.peg.2277 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Mobile element protein
fig|93061.5.peg.2181 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Mobile element protein
fig|93062.19.peg.2099 Staphylococcus aureus subsp. aureus COL FIG   Mobile element protein
gb|ABD31052.1 Staphylococcus aureus subsp. aureus NCTC 8325     transposase, putative
gb|ABD31438.1 Staphylococcus aureus subsp. aureus NCTC 8325     transposase, putative
gb|ABX30150.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     transposase
gi|160369179 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   transposase
gi|161510370 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   transposase
gi|87203242 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   transposase, putative
gi|87203628 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   transposase, putative
gi|88195684 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   transposase, putative
gi|88196070 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   transposase, putative
img|637894592 Staphylococcus aureus aureus NCTC 8325 IMG   transposase, putative
img|637895024 Staphylococcus aureus aureus NCTC 8325 IMG   transposase, putative
img|641310155 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   transposase
kegg|sao:SAOUHSC_01993 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   transposase, putative
kegg|sao:SAOUHSC_02410 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   transposase, putative
kegg|sax:USA300HOU_2155 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   transposase
ref|YP_001576029.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   transposase
ref|YP_500490.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   transposase, putative
ref|YP_500885.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   transposase, putative
tr|A8YYD0 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Transposase
tr|Q2FW90 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Transposase, putative


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search