The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1774: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
Translate Function Assignments



Context on contig NC_007795 from base 1847797 to 1857888 (10092 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1768 1848015 1847797 219 -           Hypothetical protein within pathogenicity island SaPIn3 locus|SAOUHSC_01943, protein_id|YP_500443.1, gi|88195637, geneID|3921026
1769 1848325 1848891 567 + 309         probable beta-lactamase locus|SAOUHSC_01944, protein_id|YP_500444.1, gi|88195638, geneID|3921027
1770 1850063 1849365 699 - 473         BsaG protein locus|SAOUHSC_01945, protein_id|YP_500445.1, gi|88195639, geneID|3921028
1771 1850821 1850060 762 - -4         Lantibiotic ABC transporter permease locus|SAOUHSC_01947, protein_id|YP_500446.1, gi|88195640, geneID|3920892
1772 1851510 1850818 693 - -4         Bacitracin transport ATP-binding protein bcrA locus|SAOUHSC_01948, protein_id|YP_500447.1, gi|88195641, geneID|3920893
1773 1852906 1851533 1374 - 22         Epidermin leader peptide processing serine protease epiP precursor (EC 3.4.21.-) locus|SAOUHSC_01949, protein_id|YP_500448.1, gi|88195642, geneID|3920894
1774 1853434 1852916 519 - 9     7: 2 6 3 4 7 1 5   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36) locus|SAOUHSC_01950, protein_id|YP_500449.1, gi|88195643, geneID|3920895
1775 1854694 1853450 1245 - 15         Lanthionine biosynthesis cyclase LanC locus|SAOUHSC_01951, protein_id|YP_500450.1, gi|88195644, geneID|3920896
1776 1857680 1854687 2994 - -8         Lanthionine biosynthesis protein LanB locus|SAOUHSC_01952, protein_id|YP_500451.1, gi|88195645, geneID|3920897
1777 1857888 1857745 144 - 64         lantibiotic precursor locus|SAOUHSC_01953, protein_id|YP_500452.1, gi|88195646, geneID|3920898

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CLO_DUF2520 Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
coA-FolK vcrecy Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
CoA_Test Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
Coenzyme_A_Biosynthesis AndreiO Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
dcernst_CoA_Salvage2 Ernst_Dustin_user Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
Coenzyme_A_Biosynthesis_tests ZALLOT_Remi_user Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
Pantothenate_biosynthesis_PanGenomes Smajic_Semra_user Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)


  Protein Sequence

>fig|93061.5.peg.1774 Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
MGENVLICLCGSVNSINISHYIIELKSKFDEVNVIASTNGRKFINGEILKQFCDNYYDEF
EDPFLNHVDIANKHDKIIILPATSNTINKIANGICDNLLLTICHTAFEKLSIFPNMNLRM
WENPVTQNNIRLLKDYGVSIYPANISESYELASKTFKKNVVAPEPYKVLEFI

MD5 = ed4a2cb8d8fd9e2241171ce3a7b1c734


  DNA Sequence

>fig|93061.5.peg.1774 Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
atgggagaaaatgtattgatttgtttgtgtggctcagttaatagtatcaatattagccac
tatattattgaattaaaatcaaaatttgatgaagtaaatgtaatcgcgtcaacaaacggt
agaaagtttattaatggtgaaatattaaagcaattttgcgataactattatgacgaattt
gaagacccttttttaaatcatgtagatatagcaaataaacatgacaagattattatttta
cctgcgacttctaatacgattaataaaattgcaaatggtatatgtgacaatttattatta
actatttgtcatacagcttttgaaaaactttctatatttccaaatatgaatttacgaatg
tgggaaaatccagttactcaaaataatattcgattattaaaagattatggtgtatcaata
tatccagcaaatatttcagaaagttatgaattagcgtcaaaaacatttaaaaagaatgtt
gtcgcacctgaaccatataaagttctggaattcatttga


  DNA with Flanking Sequence

>fig|93061.5.peg.1774 Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
gttacgatttaatttctgaacgtaatcatttcaattttattcggaatggttggtgttatg
gcaatacgggtgtaatgacgacgttgtttttaatcggccaagcattacaagatgatgaaa
taattaaaatgtctaaaaaagtgatgctacaagtagtaaatgataaagatgaaaatttaa
taagtccaactatttgtcatggattgtcatcacaaatattaatgttaacaattatgaatt
tgaattttgaattaaatgaagtgtctgattatatcactgtattaataaataaactgattt
ctcattataaggaagattatctggtgaattttatagacattaatgaaaataagcaagatg
tatttaaaagtaggaaagttggccttttagaaggtgaattaggggtctatctaacattga
tgacactgaaaaatacaaaaattctcaatgaaaaaaattggaccaatgcgtttttaatta
gctgaatggaggcgtatatcatgggagaaaatgtattgatttgtttgtgtggctcagtta
atagtatcaatattagccactatattattgaattaaaatcaaaatttgatgaagtaaatg
taatcgcgtcaacaaacggtagaaagtttattaatggtgaaatattaaagcaattttgcg
ataactattatgacgaatttgaagacccttttttaaatcatgtagatatagcaaataaac
atgacaagattattattttacctgcgacttctaatacgattaataaaattgcaaatggta
tatgtgacaatttattattaactatttgtcatacagcttttgaaaaactttctatatttc
caaatatgaatttacgaatgtgggaaaatccagttactcaaaataatattcgattattaa
aagattatggtgtatcaatatatccagcaaatatttcagaaagttatgaattagcgtcaa
aaacatttaaaaagaatgttgtcgcacctgaaccatataaagttctggaattcatttgag
attagaatatgaaaatcataaagcgcgctattattagtttaataatattgagtcttttaa
tatctattacaatgagtaatgcatcagcgtcagaagaactatattacagtgttgaataca
aaaatacagcaacatttaacaagttagttaaaaagaagtccttaaacgttgtctataata
taccggaattacatgtggcacagattaaaatgacgaaaatgcatgctaatgctttagcaa
actataaaaatgatattaaatatatcaatgccacatgttcaacttgtattactagcgaga
aaacaatagacagaacatcaaatgagtcattattttcaagacaatgggatatgaataaaa
taaccaataatggtgcatcgtatgatgatttgccaaaacatgctaacaccaaaatagcaa
tcatagatacaggtgtgatgaaaaaccatgacgatttgaaaaataatttctcgactgatt
ctaaaaatttagtaccttt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003824       F:catalytic activity
GO:0004633       F:phosphopantothenoylcysteine decarboxylase a...
cmr|NT03SA1910 Staphylococcus aureus MW2     epidermin biosynthesis protein EpiD
cmr|NT05SA1732 Staphylococcus aureus NCTC 8325     epidermin decarboxylase
cmr|NT09SA1727 Staphylococcus aureus subsp. aureus MSSA476     phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, putative
cmr|SACOL1875 Staphylococcus aureus subsp. aureus COL     epidermin biosynthesis protein EpiD
cmr|SAUSA300_1764 Staphylococcus aureus subsp. aureus USA300-FPR3757     lantibiotic epidermin biosynthesis protein EpiD
dbj|BAB95627.1 Staphylococcus aureus subsp. aureus MW2     bsaD
fig|196620.1.peg.1762 Staphylococcus aureus subsp. aureus MW2 FIG   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
fig|196620.5.peg.1831 Staphylococcus aureus subsp. aureus MW2 FIG   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
fig|282459.1.peg.2615 Staphylococcus aureus subsp. aureus MSSA476 FIG   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
fig|282459.5.peg.1812 Staphylococcus aureus subsp. aureus MSSA476 FIG   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
fig|367830.3.peg.1562 Staphylococcus aureus subsp. aureus USA300 FIG   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
fig|426430.6.peg.1659 Staphylococcus aureus subsp. aureus str. Newman FIG   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
fig|426430.8.peg.1854 Staphylococcus aureus subsp. aureus str. Newman FIG   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
fig|451515.3.peg.1923 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
fig|451516.9.peg.1912 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
fig|452948.4.peg.2350 Staphylococcus aureus 930918-3 FIG   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
fig|455227.3.peg.2415 Staphylococcus aureus D30 FIG   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
fig|548475.3.peg.806 Staphylococcus aureus subsp. aureus TCH70 FIG   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
fig|553567.3.peg.2186 Staphylococcus aureus A5948 FIG   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
fig|553590.4.peg.2303 Staphylococcus aureus A9754 FIG   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
fig|553594.3.peg.1755 Staphylococcus aureus A9765 FIG   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
fig|644279.4.peg.1969 Staphylococcus aureus subsp. aureus 132 FIG   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
fig|762962.3.peg.42 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
fig|93061.3.peg.1841 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
fig|93062.19.peg.1833 Staphylococcus aureus subsp. aureus COL FIG   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
fig|93062.4.peg.536 Staphylococcus aureus subsp. aureus COL FIG   Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36)
gb|AAW36890.1 Staphylococcus aureus subsp. aureus COL     epidermin biosynthesis protein EpiD
gb|ABD22271.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     lantibiotic epidermin biosynthesis protein EpiD
gb|ABD31011.1 Staphylococcus aureus subsp. aureus NCTC 8325     flavoprotein, epiD, putative
gb|ABX29815.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     lantibiotic epidermin biosynthesis protein EpiD
gb|EEW44135.1 Staphylococcus aureus 930918-3     epidermin biosynthesis protein EpiD
gb|EEW46227.1 Staphylococcus aureus D30     epidermin biosynthesis protein EpiD
gi|160368844 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   lantibiotic epidermin biosynthesis protein EpiD
gi|161510035 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   lantibiotic epidermin biosynthesis protein EpiD
gi|21204932 Staphylococcus aureus subsp. aureus MW2 NCBI   bsaD
gi|21283491 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW1762
gi|259159066 Staphylococcus aureus 930918-3 NCBI   epidermin biosynthesis protein EpiD
gi|259161633 Staphylococcus aureus D30 NCBI   epidermin biosynthesis protein EpiD
gi|57284796 Staphylococcus aureus subsp. aureus COL NCBI   epidermin biosynthesis protein EpiD
gi|57650610 Staphylococcus aureus subsp. aureus COL NCBI   epidermin biosynthesis protein EpiD
gi|87127757 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   lantibiotic epidermin biosynthesis protein EpiD
gi|87161783 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   lantibiotic epidermin biosynthesis protein EpiD
gi|87203201 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   flavoprotein, epiD, putative
gi|88195643 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   flavoprotein, epiD, putative
img|637152603 Staphylococcus aureus aureus COL IMG   epidermin biosynthesis protein EpiD
img|637299526 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637888410 Staphylococcus aureus aureus USA300 IMG   lantibiotic epidermin biosynthesis protein EpiD( EC:4.1.1.36 )
img|637894543 Staphylococcus aureus aureus NCTC 8325 IMG   flavoprotein, epiD, putative
img|641309770 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   lantibiotic epidermin biosynthesis protein EpiD
img|641772406 Staphylococcus aureus aureus USA300_TCH959 IMG   lantibiotic modifying enzyme
kegg|saa:SAUSA300_1764 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   lantibiotic epidermin biosynthesis protein EpiD (EC:4.1.1.36)
kegg|sac:SACOL1875 Staphylococcus aureus subsp. aureus COL KEGG   epidermin biosynthesis protein EpiD
kegg|sam:MW1762 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_01950 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   flavoprotein, EpiD, putative
kegg|sax:USA300HOU_1812 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   lantibiotic epidermin biosynthesis protein EpiD
ref|NP_646579.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW1762
ref|YP_001575694.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   lantibiotic epidermin biosynthesis protein EpiD
ref|YP_186703.1 Staphylococcus aureus subsp. aureus COL RefSeq   epidermin biosynthesis protein EpiD
ref|YP_494455.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   lantibiotic epidermin biosynthesis protein EpiD
ref|YP_500449.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   flavoprotein, epiD, putative
tr|A8Z4P5 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Lantibiotic epidermin biosynthesis protein EpiD
tr|Q2FFS3 Staphylococcus aureus (strain USA300) TrEMBL   Lantibiotic epidermin biosynthesis protein EpiD
tr|Q2FXB5 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Flavoprotein, epiD, putative
tr|Q5HEV4 Staphylococcus aureus (strain COL) TrEMBL   Epidermin biosynthesis protein EpiD
tr|Q8NVW8 Staphylococcus aureus (strain MW2) TrEMBL   BsaD protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search