The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1669: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
Translate Function Assignments



Context on contig NC_007795 from base 1729304 to 1742382 (13079 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1663 1730527 1729304 1224 -       2: 32 26   tRNA S(4)U 4-thiouridine synthase (former ThiI) locus|SAOUHSC_01824, protein_id|YP_500329.1, gi|88195524, geneID|3921774
1664 1731693 1730527 1167 - -1     6: 22 20 19 1 31 6   Cysteine desulfurase (EC 2.8.1.7) locus|SAOUHSC_01825, protein_id|YP_500330.1, gi|88195525, geneID|3921775
1665 1731830 1731964 135 + 136         FIG01108306: hypothetical protein locus|SAOUHSC_01826, protein_id|YP_500331.1, gi|88195526, geneID|3921776
1666 1733732 1732038 1695 - 73     2: 16 1   Septation ring formation regulator EzrA locus|SAOUHSC_01827, protein_id|YP_500332.1, gi|88195527, geneID|3921777
1667 1733869 1734333 465 + 136     1: 1   Free methionine-(R)-sulfoxide reductase, contains GAF domain locus|SAOUHSC_01828, protein_id|YP_500333.1, gi|88195528, geneID|3921778
1668 1734577 1735179 603 + 243     3: 27 8 1   SSU ribosomal protein S4p (S9e) @ SSU ribosomal protein S4p (S9e), zinc-independent gene_name|rpsD, locus|SAOUHSC_01829, protein_id|YP_500334.1, gi|88195529, geneID|3921779
1669 1736138 1735395 744 - 215         Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46) locus|SAOUHSC_01830, protein_id|YP_500336.1, gi|88195530, geneID|3921780
1670 1736218 1736664 447 + 79     2: 24 17   Organic hydroperoxide resistance protein locus|SAOUHSC_01831, protein_id|YP_500337.1, gi|88195531, geneID|3921781
1671 1736778 1737938 1161 + 113     2: 3 2   Phosphoserine aminotransferase, putative (EC 2.6.1.52) locus|SAOUHSC_01832, protein_id|YP_500338.1, gi|88195532, geneID|3921782
1672 1737925 1739529 1605 + -14     16: 4 15 3 2 28 5 25 21 11 29 7 23 30 12 18 10   D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) locus|SAOUHSC_01833, protein_id|YP_500339.1, gi|88195533, geneID|3921783
1673 1740809 1739679 1131 - 149     5: 4 3 2 13 9   Phosphoserine phosphatase (EC 3.1.3.3) locus|SAOUHSC_01835, protein_id|YP_500341.1, gi|88195535, geneID|3921785
1674 1742382 1740916 1467 - 106     1: 14   PTS system, N-acetylglucosamine-specific IIB component (EC 2.7.1.69) / PTS system, N-acetylglucosamine-specific IIC component locus|SAOUHSC_01836, protein_id|YP_500342.1, gi|88195536, geneID|3921786

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1669 Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
MTLNKLKDELQIVSHRGLPSDFPENTMVGYREVMGLNVAMLEIDVHLTKDQHFVVIHDET
IDRTSDGKGRIADYTLSQLKSFDFGSYKDVAFKGERIPTLDEVLSLCLKYDKKLLIELKS
PNLYPEIECKLLAFLEEKKVDATQVVIQSFDIECIEKLNTLGSIYELGVLCSKRNYWYKK
PNFSRIAQIASYVNPNYALVTRKFVDKAHHHQLQVMPYTVNKLKTGEKLRQMGVDGLITD
NPKLFIK

MD5 = f987517546cf6169e5269994a5d98816


  DNA Sequence

>fig|93061.5.peg.1669 Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
atgactctgaataaactgaaagatgaattacaaattgtttcgcaccgtggattgccgagt
gattttcctgaaaatacaatggtcggttatcgagaggtaatggggctcaatgttgctatg
ttagaaatagatgttcatttgaccaaagaccaacattttgttgtgatacatgatgaaaca
attgatagaacatcggatggtaaggggcgtattgctgattacacattatcgcaattaaaa
tcatttgattttggtagttataaagatgttgcttttaagggagaacgaatacccacgtta
gatgaagtactttcattatgcttaaagtatgataaaaagctattgattgaattgaaaagt
ccgaatttatatccagaaatagaatgtaaattgctggcatttttggaagaaaagaaagtc
gatgcgacacaagtagttatacaatcttttgatatcgaatgcatcgaaaagttaaacaca
ttgggcagtatatatgaattaggtgtgctttgtagtaaacgtaattattggtataaaaag
ccaaacttttcaagaattgctcaaattgctagttatgttaatcctaattatgcattagtg
accagaaaatttgttgataaagcacatcatcatcaattacaggttatgccatacacagtt
aataaattgaaaactggagaaaaattaagacaaatgggtgtagatggattaattacagat
aatccgaaattatttattaagtga


  DNA with Flanking Sequence

>fig|93061.5.peg.1669 Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
tttttatgtccacattatttcttacagcatttgaaatcatgcaattattatctgcaattg
ttatcaattttggtaatcgcttttctaattgtgctatttgatcacttggaatttgaattt
gaggatggtgcacaatttttgacatactgaattttccgttatttaaacaagctgttccaa
tcgattgttgttcaattgaaatatctgtgaactttgcacgttcaagagtagctgctaatg
agatgatataacatgatgaagcggctgatactaacatttcatcgggatttgttcctatac
caacaccacctaaagaagcaggtatagaaatattctctgaaagtatgtcgccttgaacgt
ttccgacattgttacgaccaccttgccaagaagtttggactttaaagtcatgttgatgca
attgctttaacctccaatataattgtgatagtttaattttagaatagtttatcaaagttt
aacagaaaggtgacttatcaatgactctgaataaactgaaagatgaattacaaattgttt
cgcaccgtggattgccgagtgattttcctgaaaatacaatggtcggttatcgagaggtaa
tggggctcaatgttgctatgttagaaatagatgttcatttgaccaaagaccaacattttg
ttgtgatacatgatgaaacaattgatagaacatcggatggtaaggggcgtattgctgatt
acacattatcgcaattaaaatcatttgattttggtagttataaagatgttgcttttaagg
gagaacgaatacccacgttagatgaagtactttcattatgcttaaagtatgataaaaagc
tattgattgaattgaaaagtccgaatttatatccagaaatagaatgtaaattgctggcat
ttttggaagaaaagaaagtcgatgcgacacaagtagttatacaatcttttgatatcgaat
gcatcgaaaagttaaacacattgggcagtatatatgaattaggtgtgctttgtagtaaac
gtaattattggtataaaaagccaaacttttcaagaattgctcaaattgctagttatgtta
atcctaattatgcattagtgaccagaaaatttgttgataaagcacatcatcatcaattac
aggttatgccatacacagttaataaattgaaaactggagaaaaattaagacaaatgggtg
tagatggattaattacagataatccgaaattatttattaagtgagacgatgaatggtaat
ttgatagagggatgaggattcgtatatcgcaattgataattttaaaaactaatgatgaaa
tactaaagataattaaacaaataagacttgtaaattctaagttgattgtaaaatagggta
gctccatataattttgaatctatcatttttaaattaataaaaaaaacacccacaattgtg
ggtgtttgtattgaacgtattatcttgagtagtactcaacgattaattgttcgttaattt
cagcaggtaattcgctacgttctggtaaacgtacgaaagtaccagttaagctgtcagcat
caaagtttaagtactcaggtacgaaattgttgatttcaactgattcaacgatgatgttta
atttttgagatttttcacgaactgaaattgtttgaccaggtttaacagaataagatggaa
tatcaacacgtttaccatctactaagatatgaccgtggttaactaattgacgtgcttgac
gacg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0006071       P:glycerol metabolic process
GO:0006629       P:lipid metabolic process
GO:0008889       F:glycerophosphodiester phosphodiesterase act...
cmr|NT05SA1631 Staphylococcus aureus NCTC 8325     glycerophosphoryl diester phosphodiesterase
cmr|SACOL1770 Staphylococcus aureus subsp. aureus COL     glycerophosphoryl diester phosphodiesterase, putative
cmr|SAUSA300_1667 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative glycerophosphoryl diester phosphodiesterase
dbj|BAF67886.1 Staphylococcus aureus subsp. aureus str. Newman     glycerophosphoryl diester phosphodiesterase
fig|367830.3.peg.1008 Staphylococcus aureus subsp. aureus USA300 FIG   Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
fig|426430.6.peg.1565 Staphylococcus aureus subsp. aureus str. Newman FIG   Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
fig|426430.8.peg.1747 Staphylococcus aureus subsp. aureus str. Newman FIG   Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
fig|451515.3.peg.1818 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
fig|451516.9.peg.1807 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
fig|452948.4.peg.832 Staphylococcus aureus 930918-3 FIG   Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
fig|455227.3.peg.1053 Staphylococcus aureus D30 FIG   Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
fig|546342.3.peg.939 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
fig|546343.3.peg.2417 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
fig|548474.3.peg.2174 Staphylococcus aureus subsp. aureus TCH130 FIG   Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
fig|553567.3.peg.375 Staphylococcus aureus A5948 FIG   Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
fig|553590.4.peg.1942 Staphylococcus aureus A9754 FIG   Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
fig|553594.3.peg.1817 Staphylococcus aureus A9765 FIG   Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
fig|644279.4.peg.1866 Staphylococcus aureus subsp. aureus 132 FIG   Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
fig|93061.3.peg.1665 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
fig|93062.19.peg.1727 Staphylococcus aureus subsp. aureus COL FIG   Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
fig|93062.4.peg.437 Staphylococcus aureus subsp. aureus COL FIG   Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)
gb|AAW38299.1 Staphylococcus aureus subsp. aureus COL     glycerophosphoryl diester phosphodiesterase, putative
gb|ABD20949.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative glycerophosphoryl diester phosphodiesterase
gb|ABD30898.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX29716.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     glycerophosphodiester phosphodiesterase
gb|EES96278.1 Staphylococcus aureus subsp. aureus TCH130     possible glycerophosphodiester phosphodiesterase
gb|EEV84229.1 Staphylococcus aureus A5948     glycerophosphoryl diester phosphodiesterase
gb|EEW45325.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0466
gb|EEW47415.1 Staphylococcus aureus D30     hypothetical protein SAD30_2239
gi|150374626 Staphylococcus aureus subsp. aureus str. Newman NCBI   glycerophosphoryl diester phosphodiesterase
gi|151221826 Staphylococcus aureus subsp. aureus str. Newman NCBI   glycerophosphoryl diester phosphodiesterase
gi|160368745 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   glycerophosphodiester phosphodiesterase
gi|161509936 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   glycerophosphodiester phosphodiesterase
gi|221137951 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   glycerophosphodiester phosphodiesterase
gi|221142355 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   glycerophosphodiester phosphodiesterase
gi|253727549 Staphylococcus aureus subsp. aureus TCH130 NCBI   possible glycerophosphodiester phosphodiesterase
gi|253734495 Staphylococcus aureus subsp. aureus TCH130 NCBI   possible glycerophosphodiester phosphodiesterase
gi|257861421 Staphylococcus aureus A5948 NCBI   glycerophosphoryl diester phosphodiesterase
gi|258450885 Staphylococcus aureus A5948 NCBI   glycerophosphoryl diester phosphodiesterase
gi|259160298 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0466
gi|259162851 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_2239
gi|57286205 Staphylococcus aureus subsp. aureus COL NCBI   glycerophosphoryl diester phosphodiesterase, putative
gi|57652019 Staphylococcus aureus subsp. aureus COL NCBI   glycerophosphoryl diester phosphodiesterase, putative
gi|87126435 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative glycerophosphoryl diester phosphodiesterase
gi|87160461 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative glycerophosphoryl diester phosphodiesterase
gi|87203088 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88195530 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01830
img|637152504 Staphylococcus aureus aureus COL IMG   glycerophosphoryl diester phosphodiesterase, putative
img|637888316 Staphylococcus aureus aureus USA300 IMG   putative glycerophosphoryl diester phosphodiesterase
img|637894430 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640795995 Staphylococcus aureus aureus Newman IMG   glycerophosphoryl diester phosphodiesterase
img|641309669 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   glycerophosphodiester phosphodiesterase( EC:3.1.4.46 )
img|641771632 Staphylococcus aureus aureus USA300_TCH959 IMG   glycerophosphodiester phosphodiesterase
kegg|saa:SAUSA300_1667 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   putative glycerophosphoryl diester phosphodiesterase
kegg|sac:SACOL1770 Staphylococcus aureus subsp. aureus COL KEGG   glycerophosphoryl diester phosphodiesterase, putative
kegg|sae:NWMN_1614 Staphylococcus aureus subsp. aureus Newman KEGG   glycerophosphoryl diester phosphodiesterase
kegg|sao:SAOUHSC_01830 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_1709 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   glycerophosphodiester phosphodiesterase (EC:3.1.4.46)
ref|YP_001332648.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   glycerophosphoryl diester phosphodiesterase
ref|YP_001575595.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   glycerophosphodiester phosphodiesterase
ref|YP_186604.1 Staphylococcus aureus subsp. aureus COL RefSeq   glycerophosphoryl diester phosphodiesterase, putative
ref|YP_494361.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   putative glycerophosphoryl diester phosphodiesterase
ref|YP_500336.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01830
ref|ZP_03562753.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   glycerophosphodiester phosphodiesterase
ref|ZP_03566848.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   glycerophosphodiester phosphodiesterase
ref|ZP_04868660.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   possible glycerophosphodiester phosphodiesterase
ref|ZP_05698938.1 Staphylococcus aureus A5948 RefSeq   glycerophosphoryl diester phosphodiesterase
tr|A6QHQ4 Staphylococcus aureus (strain Newman) TrEMBL   Glycerophosphoryl diester phosphodiesterase
tr|A8Z2N8 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Glycerophosphodiester phosphodiesterase
tr|C5Q3E1 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Possible glycerophosphodiester phosphodiesterase
tr|Q2FG17 Staphylococcus aureus (strain USA300) TrEMBL   Putative glycerophosphoryl diester phosphodiesterase
tr|Q2FXK4 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HF53 Staphylococcus aureus (strain COL) TrEMBL   Glycerophosphoryl diester phosphodiesterase, putative


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search