The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1489: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Late competence protein ComGF, access of DNA to ComEA, FIG017774
Translate Function Assignments



Context on contig NC_007795 from base 1551986 to 1562277 (10292 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1485 1553458 1551986 1473 -       5: 17 7 3 2 8   Glycine dehydrogenase [decarboxylating] (glycine cleavage system P2 protein) (EC 1.4.4.2) locus|SAOUHSC_01632, protein_id|YP_500145.1, gi|88195341, geneID|3919969
1486 1554797 1553451 1347 - -8     2: 3 2   Glycine dehydrogenase [decarboxylating] (glycine cleavage system P1 protein) (EC 1.4.4.2) locus|SAOUHSC_01633, protein_id|YP_500146.1, gi|88195342, geneID|3919970
1487 1555908 1554817 1092 - 19     3: 3 2 5   Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10) gene_name|gcvT, locus|SAOUHSC_01634, protein_id|YP_500147.1, gi|88195343, geneID|3919971
1488 1556591 1556067 525 - 158     5: 12 15 10 14 18   Shikimate kinase I (EC 2.7.1.71) locus|SAOUHSC_01635, protein_id|YP_500148.1, gi|88195344, geneID|3919972
1489 1557213 1556824 390 - 232     1: 1   Late competence protein ComGF, access of DNA to ComEA, FIG017774 locus|SAOUHSC_01637, protein_id|YP_500150.1, gi|88195346, geneID|3919974
1490 1557538 1557239 300 - 25     1: 1   Late competence protein ComGE, FIG018915 locus|SAOUHSC_01638, protein_id|YP_500151.1, gi|88195347, geneID|3920091
1491 1557929 1557525 405 - -14     1: 1   Late competence protein ComGD, access of DNA to ComEA, FIG012777 locus|SAOUHSC_01639, protein_id|YP_500152.1, gi|88195348, geneID|3920092
1492 1558260 1557949 312 - 19     1: 1   Late competence protein ComGC, access of DNA to ComEA, FIG007487 locus|SAOUHSC_01640, protein_id|YP_500153.1, gi|88195349, geneID|3920093
1493 1559194 1558274 921 - 13     2: 1 4   Late competence protein ComGB, access of DNA to ComEA locus|SAOUHSC_01641, protein_id|YP_500154.1, gi|88195350, geneID|3920094
1494 1560290 1559316 975 - 121     2: 1 4   Late competence protein ComGA, access of DNA to ComEA locus|SAOUHSC_01643, protein_id|YP_500155.1, gi|88195351, geneID|3920095
1495 1560965 1560342 624 - 51     4: 9 11 16 13   MBL-fold metallo-hydrolase superfamily locus|SAOUHSC_01644, protein_id|YP_500156.1, gi|88195352, geneID|3920096
1496 1561291 1560962 330 - -4         DUF77 protein YqgV locus|SAOUHSC_01645, protein_id|YP_500157.1, gi|88195353, geneID|3920097
1497 1562277 1561291 987 - -1     1: 6   Glucokinase (EC 2.7.1.2) locus|SAOUHSC_01646, protein_id|YP_500158.1, gi|88195354, geneID|3920098

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Late_competence VeronikaV Late competence protein ComGF, access of DNA to ComEA, FIG017774


  Protein Sequence

>fig|93061.5.peg.1489 Late competence protein ComGF, access of DNA to ComEA, FIG017774
MLVAMMVISITLLIVPDLIRLSKTFLIESRDLTTVDFEFFSRDILDDFKGVDRNDIEIRQ
HRIILHKGEEMIEYKLINNKIIKVVNDRGNITMINNVTAFTANIYYKSIIKITITVKVGT
NVQTKTIYV

MD5 = fa2b6f40abf7022f0a1d664ed4d7bef9


  DNA Sequence

>fig|93061.5.peg.1489 Late competence protein ComGF, access of DNA to ComEA, FIG017774
atgttagtagcgatgatggttataagtataactttactaattgttccagacttaattaga
cttagtaaaacttttctaattgaaagtagggatttaacaactgtagatttcgaatttttc
tcaagagatattctagatgattttaaaggagtagatagaaacgatattgaaattaggcaa
caccgtatcattttacataaaggtgaagaaatgatcgaatacaaattaattaataataaa
attattaaagttgtaaatgacagaggaaatataacaatgattaataatgttacagcattt
actgcaaatatctactataaatccattattaaaataacgataacagttaaagtcggtaca
aatgtgcagactaaaactatttatgtataa


  DNA with Flanking Sequence

>fig|93061.5.peg.1489 Late competence protein ComGF, access of DNA to ComEA, FIG017774
aataataaaatacgatttctaaaattaaaagtaggcaaaataattaatgttgcaaaagtt
gatattattgcctttgataaaaaagggaatatcaataaatttggtagcataacaatttac
aataacaattcaatttatagaataatattccatattgaaaaaggaagaattcgttatgaa
aagctataagtgtaaaggttcattcttaatagatagtatggctggatttttgctaattgg
attgattacattactattgataccaatgatgaatcaaatgcaagcgagtataaaccataa
actacaaacaattgatgcttctaaagtaattttgacgactgtatctaaaattaataaaga
agaacttaagaagggggtaactatagggaagtatgatattaagcaaagtgaccaacaaat
ttgtgctatttcaaaaaataccacttcttatcaaaagacatgtatacagtattaatgtca
aagctttttcgctcattgaaatgttagtagcgatgatggttataagtataactttactaa
ttgttccagacttaattagacttagtaaaacttttctaattgaaagtagggatttaacaa
ctgtagatttcgaatttttctcaagagatattctagatgattttaaaggagtagatagaa
acgatattgaaattaggcaacaccgtatcattttacataaaggtgaagaaatgatcgaat
acaaattaattaataataaaattattaaagttgtaaatgacagaggaaatataacaatga
ttaataatgttacagcatttactgcaaatatctactataaatccattattaaaataacga
taacagttaaagtcggtacaaatgtgcagactaaaactatttatgtataacttactagta
tttaaatgagtactattaaaaaggatgtgaaataatttattaattttgatttatataaag
aaaaaggatatgttacgccgttcttattgatgctaacagcaatttatttttccattttca
ctttttatatcagtcaatatagtttaaaattaaagacattatataatattgaaactgact
ataactataagattgttttgttattgaaagaagggaaaacgcatgaatcatgataaatca
ccaataattttaattggtttcatgggtaccggtaaatctacgattggtaaatacgttgca
gatgagcaaaatttatcatttattgatatagattcatatatcgaagagaagtataagtta
acaataccagaaatattttgtaaacatggtgaacaatatttcaggaatttagagttcaca
tgtttgcaagaatgtattaacactgcagatataattgctactggtggtggtattattgag
agtgaagagg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|426430.8.peg.1570 Staphylococcus aureus subsp. aureus str. Newman FIG   Late competence protein ComGF, access of DNA to ComEA, FIG017774
fig|452948.4.peg.238 Staphylococcus aureus 930918-3 FIG   Late competence protein ComGF, access of DNA to ComEA, FIG017774
fig|455227.3.peg.1126 Staphylococcus aureus D30 FIG   Late competence protein ComGF, access of DNA to ComEA, FIG017774
fig|762962.3.peg.447 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Late competence protein ComGF, access of DNA to ComEA, FIG017774


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search