The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1471: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Arginine pathway regulatory protein ArgR, repressor of arg regulon
Translate Function Assignments



Context on contig NC_007795 from base 1535924 to 1546683 (10760 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1467 1536907 1535924 984 -       3: 4 1 2   Branched-chain alpha-keto acid dehydrogenase, E1 component, beta subunit (EC 1.2.4.4) locus|SAOUHSC_01612, protein_id|YP_500127.1, gi|88195323, geneID|3920028
1468 1537899 1536907 993 - -1     3: 4 1 2   Branched-chain alpha-keto acid dehydrogenase, E1 component, alpha subunit (EC 1.2.4.4) locus|SAOUHSC_01613, protein_id|YP_500128.1, gi|88195324, geneID|3920029
1469 1539336 1537915 1422 - 15     3: 4 1 2   Dihydrolipoamide dehydrogenase of branched-chain alpha-keto acid dehydrogenase (EC 1.8.1.4) locus|SAOUHSC_01614, protein_id|YP_500129.1, gi|88195325, geneID|3920030
1470 1541166 1539487 1680 - 150 26 2: 3 16   DNA repair protein RecN locus|SAOUHSC_01615, protein_id|YP_500130.1, gi|88195326, geneID|3920031
1471 1541634 1541182 453 - 15   1: 19   Arginine pathway regulatory protein ArgR, repressor of arg regulon locus|SAOUHSC_01617, protein_id|YP_500131.1, gi|88195327, geneID|3920032
1472 1542947 1542066 882 - 431 16 7: 12 15 6 7 9 17 10   Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29) locus|SAOUHSC_01618, protein_id|YP_500132.1, gi|88195328, geneID|3919956
1473 1543155 1542925 231 - -23 11 1: 3   Exodeoxyribonuclease VII small subunit (EC 3.1.11.6) locus|SAOUHSC_01619, protein_id|YP_500133.1, gi|88195329, geneID|3919957
1474 1544485 1543148 1338 - -8 11 1: 3   Exodeoxyribonuclease VII large subunit (EC 3.1.11.6) gene_name|xseA, locus|SAOUHSC_01620, protein_id|YP_500134.1, gi|88195330, geneID|3919958
1475 1544891 1544502 390 - 16     2: 8 18   Transcription termination protein NusB gene_name|nusB, locus|SAOUHSC_01621, protein_id|YP_500135.1, gi|88195331, geneID|3919959
1476 1545313 1544951 363 - 59         FIG01107926: hypothetical protein locus|SAOUHSC_01622, protein_id|YP_500136.1, gi|88195332, geneID|3919960
1477 1546683 1545328 1356 - 14     4: 11 5 14 13   Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14) locus|SAOUHSC_01623, protein_id|YP_500137.1, gi|88195333, geneID|3919961

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Arginine_Biosynthesis_extended OlgaZ Arginine pathway regulatory protein ArgR, repressor of arg regulon


  Protein Sequence

>fig|93061.5.peg.1471 Arginine pathway regulatory protein ArgR, repressor of arg regulon
MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQ
YVYSLPNDRKFHPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVL
GTICGDDTCLIICRSKEASDEIKSRIFNLL

MD5 = 8b658cf29dbb0e4d51d46af946da0541


  DNA Sequence

>fig|93061.5.peg.1471 Arginine pathway regulatory protein ArgR, repressor of arg regulon
gtgcccaaaaaatcggttaggcatataaaaattagagaaattatttcaaatgaacagata
gagacacaagatgaattagttaaacgattaaacgattatgatttaaatgtcactcaagca
actgtttctcgtgatattaaagaactacaacttattaaagtacctataccttcaggtcaa
tatgtttatagtttaccaaatgatagaaaattccatcctttagaaaaattgggacgttat
ttaatggattcctttgttaatatagatggtactgataatttacttgttctaaaaacatta
cctggtaatgcacaatctattggagctatattagaccaaatcaattgggaagaagtacta
ggcacaatttgtggtgatgatacttgtttaattatttgtcgaagcaaagaggcaagtgat
gaaatcaagtcaagaattttcaatttgttataa


  DNA with Flanking Sequence

>fig|93061.5.peg.1471 Arginine pathway regulatory protein ArgR, repressor of arg regulon
attgatgaacaattcaatacaaaacacttattagaaatcgttgatttattttatagcagg
gatcactaaaagcaaatatatcgattagcaacaattgtaaagtttgaaatgtctcaaaag
gcatattcaactgacgttgtttgttaatcgatttttctcatgttgaaacttaaaattatg
ttgaagactttcatttaaaaaatagaattttcaatttctatacgacaatattcgtatctg
tgatatcaatgtgattttaattaaatatgttcaaacaattgacgcttattaaatctaata
attagcaagtttattacacatatattcatttttatacatattttaagcaattgttatgcg
taatatgaaaaatatttataaatagataaccaagatagataaaccatgtttacccttttt
acgtaaaggtgtttagtagtcgtaaatcagtgcatgtgttaaaataaatgtataaatatt
cgtaatcagaggtgtttactgtgcccaaaaaatcggttaggcatataaaaattagagaaa
ttatttcaaatgaacagatagagacacaagatgaattagttaaacgattaaacgattatg
atttaaatgtcactcaagcaactgtttctcgtgatattaaagaactacaacttattaaag
tacctataccttcaggtcaatatgtttatagtttaccaaatgatagaaaattccatcctt
tagaaaaattgggacgttatttaatggattcctttgttaatatagatggtactgataatt
tacttgttctaaaaacattacctggtaatgcacaatctattggagctatattagaccaaa
tcaattgggaagaagtactaggcacaatttgtggtgatgatacttgtttaattatttgtc
gaagcaaagaggcaagtgatgaaatcaagtcaagaattttcaatttgttataaggatgcg
atgagtttatgttacaaaccttatcaatcaagcaatttgctattattgaagaattagaaa
ttcaattttctgatggtttaactgttttaagtggtgaaacgggttcaggtaagtcaatta
ttatagatgcaattggacaattaattggaatgagagcttcatctgattttgtaagacatg
gtgaaaaaaaggctgtcatcgaaggtatatttgatattgacgagagtaaagatgctatac
atatattgaaaaatatggatattgatgtagatgaagattttttattagttaaacgggaaa
ttttcagctctggtaaaagtctttgtaaaattaataatcaaacagttactttacaagatt
tacgaaaagttatgcaagaattattagatattcatggccaacatgaaacgcagtctttgt
tgaaacaaaaataccatttaacattattggataattacgcagaatcacgttatcaagatt
tgttggataaata


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003700       F:transcription factor activity
GO:0005737       C:cytoplasm
GO:0006350       P:transcription
GO:0006355       P:regulation of transcription, DNA-dependent
GO:0006526       P:arginine biosynthetic process
cmr|NT01SA1480 Staphylococcus aureus N315     arginine repressor
cmr|NT02SA1507 Staphylococcus aureus Mu50     arginine repressor
cmr|NT03SA1604 Staphylococcus aureus MW2     arginine repressor
cmr|NT05SA1440 Staphylococcus aureus NCTC 8325     arginine repressor
cmr|NT08SA1554 Staphylococcus aureus subsp. aureus MRSA252     arginine repressor
cmr|NT09SA1446 Staphylococcus aureus subsp. aureus MSSA476     arginine repressor
cmr|NT11SA1413 Staphylococcus aureus RF122     arginine repressor
cmr|SACOL1565 Staphylococcus aureus subsp. aureus COL     arginine repressor
cmr|SAUSA300_1469 Staphylococcus aureus subsp. aureus USA300-FPR3757     arginine repressor
dbj|BAB42613.1 Staphylococcus aureus subsp. aureus N315     arginine repressor
dbj|BAB57682.1 Staphylococcus aureus subsp. aureus Mu50     arginine repressor
dbj|BAB95338.1 Staphylococcus aureus subsp. aureus MW2     arginine repressor
dbj|BAF67698.1 Staphylococcus aureus subsp. aureus str. Newman     arginine repressor
dbj|BAF78391.1 Staphylococcus aureus subsp. aureus Mu3     arginine repressor
emb|CAG40593.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   arginine repressor
emb|CAG43246.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   arginine repressor
emb|CAI81082.1 Staphylococcus aureus RF122 EMBL   arginine repressor
fig|158878.1.peg.1520 Staphylococcus aureus subsp. aureus Mu50 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|158878.14.peg.1567 Staphylococcus aureus subsp. aureus Mu50 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|158879.1.peg.1396 Staphylococcus aureus subsp. aureus N315 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|158879.11.peg.1456 Staphylococcus aureus subsp. aureus N315 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|196620.1.peg.1473 Staphylococcus aureus subsp. aureus MW2 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|196620.5.peg.1539 Staphylococcus aureus subsp. aureus MW2 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|273036.3.peg.1209 Staphylococcus aureus RF122 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|273036.6.peg.1481 Staphylococcus aureus RF122 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|282458.1.peg.1512 Staphylococcus aureus subsp. aureus MRSA252 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|282458.4.peg.1602 Staphylococcus aureus subsp. aureus MRSA252 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|282459.1.peg.1445 Staphylococcus aureus subsp. aureus MSSA476 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|282459.5.peg.1519 Staphylococcus aureus subsp. aureus MSSA476 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|359786.13.peg.1670 Staphylococcus aureus subsp. aureus JH9 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|359786.3.peg.164 Staphylococcus aureus subsp. aureus JH9 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|359787.3.peg.1372 Staphylococcus aureus subsp. aureus JH1 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|367830.3.peg.2310 Staphylococcus aureus subsp. aureus USA300 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|418127.4.peg.1403 Staphylococcus aureus subsp. aureus Mu3 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|426430.6.peg.1385 Staphylococcus aureus subsp. aureus str. Newman FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|426430.8.peg.1552 Staphylococcus aureus subsp. aureus str. Newman FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|451515.3.peg.1607 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|451516.9.peg.1612 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|452948.4.peg.256 Staphylococcus aureus 930918-3 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|455227.3.peg.1107 Staphylococcus aureus D30 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|505321.3.peg.344 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|546342.3.peg.809 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|546343.3.peg.63 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|548470.3.peg.2320 Staphylococcus aureus subsp. aureus MN8 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|548473.3.peg.1753 Staphylococcus aureus subsp. aureus TCH60 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|548474.3.peg.789 Staphylococcus aureus subsp. aureus TCH130 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|548475.3.peg.510 Staphylococcus aureus subsp. aureus TCH70 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|553565.3.peg.219 Staphylococcus aureus A5937 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|553567.3.peg.664 Staphylococcus aureus A5948 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|553568.3.peg.997 Staphylococcus aureus A6224 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|553571.3.peg.1802 Staphylococcus aureus A6300 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|553573.3.peg.1351 Staphylococcus aureus A8115 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|553574.3.peg.365 Staphylococcus aureus A8117 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|553577.3.peg.1844 Staphylococcus aureus A8796 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|553580.3.peg.1782 Staphylococcus aureus A8819 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|553581.3.peg.1389 Staphylococcus aureus A9299 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|553583.3.peg.685 Staphylococcus aureus A9635 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|553588.3.peg.416 Staphylococcus aureus A9719 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|553590.4.peg.609 Staphylococcus aureus A9754 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|553592.3.peg.1414 Staphylococcus aureus A9763 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|553594.3.peg.1959 Staphylococcus aureus A9765 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|553601.3.peg.2366 Staphylococcus aureus A10102 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|585143.3.peg.2054 Staphylococcus aureus subsp. aureus 55/2053 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|585144.3.peg.2079 Staphylococcus aureus subsp. aureus 58-424 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|585145.3.peg.1783 Staphylococcus aureus subsp. aureus 65-1322 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|585146.3.peg.2051 Staphylococcus aureus subsp. aureus 68-397 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|585147.3.peg.1127 Staphylococcus aureus subsp. aureus A017934/97 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|585148.3.peg.1104 Staphylococcus aureus subsp. aureus Btn1260 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|585149.6.peg.1691 Staphylococcus aureus subsp. aureus C101 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|585150.3.peg.1779 Staphylococcus aureus subsp. aureus C160 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|585151.3.peg.738 Staphylococcus aureus subsp. aureus C427 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|585152.3.peg.1512 Staphylococcus aureus subsp. aureus D139 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|585153.3.peg.1798 Staphylococcus aureus subsp. aureus E1410 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|585154.3.peg.1220 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|585155.3.peg.1740 Staphylococcus aureus subsp. aureus H19 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|585156.3.peg.1072 Staphylococcus aureus subsp. aureus M1015 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|585157.3.peg.1251 Staphylococcus aureus subsp. aureus M809 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|585158.3.peg.2039 Staphylococcus aureus subsp. aureus M876 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|585159.3.peg.1595 Staphylococcus aureus subsp. aureus M899 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|585160.3.peg.1061 Staphylococcus aureus subsp. aureus WBG10049 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|585161.3.peg.1236 Staphylococcus aureus subsp. aureus WW2703/97 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|585891.3.peg.1564 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|644279.4.peg.1672 Staphylococcus aureus subsp. aureus 132 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|680649.3.peg.453 Staphylococcus aureus subsp. aureus MR1 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|681288.4.peg.1511 Staphylococcus aureus subsp. aureus ED98 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|703339.3.peg.1506 Staphylococcus aureus 04-02981 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|762962.3.peg.465 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|93061.3.peg.1523 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
fig|93062.4.peg.1798 Staphylococcus aureus subsp. aureus COL FIG   Arginine pathway regulatory protein ArgR, repressor of arg regulon
gb|AAW36757.1 Staphylococcus aureus subsp. aureus COL     arginine repressor
gb|ABD20514.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     arginine repressor
gb|ABD30695.1 Staphylococcus aureus subsp. aureus NCTC 8325     arginine repressor
gb|ABQ49372.1 Staphylococcus aureus subsp. aureus JH9     transcriptional regulator, ArgR family
gb|ABR52460.1 Staphylococcus aureus subsp. aureus JH1     arginine repressor
gb|EEJ61725.1 Staphylococcus aureus subsp. aureus TCH60     arginine repressor
gb|EES97499.1 Staphylococcus aureus subsp. aureus TCH130     arginine repressor
gb|EEV03486.1 Staphylococcus aureus subsp. aureus 55/2053     arginine repressor
gb|EEV06635.1 Staphylococcus aureus subsp. aureus 65-1322     arginine repressor
gb|EEV09010.1 Staphylococcus aureus subsp. aureus 68-397     arginine repressor
gb|EEV11863.1 Staphylococcus aureus subsp. aureus E1410     arginine repressor
gb|EEV14020.1 Staphylococcus aureus subsp. aureus M876     arginine repressor
gb|EEV25909.1 Staphylococcus aureus A9781     arginine repressor
gb|EEV64717.1 Staphylococcus aureus A9763     arginine repressor
gb|EEV68198.1 Staphylococcus aureus A9719     arginine repressor
gb|EEV70645.1 Staphylococcus aureus A9635     arginine repressor
gb|EEV72546.1 Staphylococcus aureus A9299     arginine repressor
gb|EEV74908.1 Staphylococcus aureus A8115     arginine repressor
gb|EEV77290.1 Staphylococcus aureus A6300     arginine repressor
gb|EEV80847.1 Staphylococcus aureus A6224     arginine repressor
gb|EEV84046.1 Staphylococcus aureus A5948     arginine repressor
gb|EEV86978.1 Staphylococcus aureus A5937     arginine repressor
gb|EEW45844.1 Staphylococcus aureus 930918-3     arginine repressor
gb|EEW47340.1 Staphylococcus aureus D30     arginine repressor
gi|123003459 organism not parsed/found in ncbi nr NCBI   RecName: Full=Arginine repressor
gi|123749611 organism not parsed/found in ncbi nr NCBI   RecName: Full=Arginine repressor
gi|123754654 organism not parsed/found in ncbi nr NCBI   RecName: Full=Arginine repressor
gi|13701319 Staphylococcus aureus subsp. aureus N315 NCBI   arginine repressor
gi|14247291 Staphylococcus aureus subsp. aureus Mu50 NCBI   arginine repressor
gi|147741074 Staphylococcus aureus subsp. aureus JH9 NCBI   transcriptional regulator, ArgR family
gi|148268005 Staphylococcus aureus subsp. aureus JH9 NCBI   arginine repressor
gi|149946524 Staphylococcus aureus subsp. aureus JH1 NCBI   arginine repressor
gi|150374438 Staphylococcus aureus subsp. aureus str. Newman NCBI   arginine repressor
gi|150394072 Staphylococcus aureus subsp. aureus JH1 NCBI   arginine repressor
gi|151221638 Staphylococcus aureus subsp. aureus str. Newman NCBI   arginine repressor
gi|156721974 Staphylococcus aureus subsp. aureus Mu3 NCBI   arginine repressor
gi|156979839 Staphylococcus aureus subsp. aureus Mu3 NCBI   arginine repressor
gi|15924510 Staphylococcus aureus subsp. aureus Mu50 NCBI   arginine repressor
gi|15927101 Staphylococcus aureus subsp. aureus N315 NCBI   arginine repressor
gi|166217520 organism not parsed/found in ncbi nr NCBI   RecName: Full=Arginine repressor
gi|172048897 organism not parsed/found in ncbi nr NCBI   RecName: Full=Arginine repressor
gi|189045970 organism not parsed/found in ncbi nr NCBI   RecName: Full=Arginine repressor
gi|189045971 organism not parsed/found in ncbi nr NCBI   RecName: Full=Arginine repressor
gi|21204642 Staphylococcus aureus subsp. aureus MW2 NCBI   arginine repressor
gi|21283202 Staphylococcus aureus subsp. aureus MW2 NCBI   arginine repressor
gi|221137830 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   arginine repressor
gi|221140059 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   arginine repressor
gi|227851927 Staphylococcus aureus subsp. aureus TCH60 NCBI   arginine repressor
gi|227899967 Staphylococcus aureus subsp. aureus TCH60 NCBI   arginine repressor
gi|253314890 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   arginine repressor
gi|253728770 Staphylococcus aureus subsp. aureus TCH130 NCBI   arginine repressor
gi|253733230 Staphylococcus aureus subsp. aureus TCH130 NCBI   arginine repressor
gi|255006307 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   arginine repressor
gi|257271340 Staphylococcus aureus subsp. aureus 55/2053 NCBI   arginine repressor
gi|257275148 Staphylococcus aureus subsp. aureus 65-1322 NCBI   arginine repressor
gi|257278374 Staphylococcus aureus subsp. aureus 68-397 NCBI   arginine repressor
gi|257281726 Staphylococcus aureus subsp. aureus E1410 NCBI   arginine repressor
gi|257283897 Staphylococcus aureus subsp. aureus M876 NCBI   arginine repressor
gi|257425646 Staphylococcus aureus subsp. aureus 55/2053 NCBI   arginine repressor
gi|257428307 Staphylococcus aureus subsp. aureus 65-1322 NCBI   arginine repressor
gi|257430944 Staphylococcus aureus subsp. aureus 68-397 NCBI   arginine repressor
gi|257433633 Staphylococcus aureus subsp. aureus E1410 NCBI   arginine repressor
gi|257436546 Staphylococcus aureus subsp. aureus M876 NCBI   arginine repressor
gi|257787569 Staphylococcus aureus A9781 NCBI   arginine repressor
gi|257793597 Staphylococcus aureus A9781 NCBI   arginine repressor
gi|257840253 Staphylococcus aureus A9763 NCBI   arginine repressor
gi|257843804 Staphylococcus aureus A9719 NCBI   arginine repressor
gi|257846624 Staphylococcus aureus A9635 NCBI   arginine repressor
gi|257848558 Staphylococcus aureus A9299 NCBI   arginine repressor
gi|257850965 Staphylococcus aureus A8115 NCBI   arginine repressor
gi|257854341 Staphylococcus aureus A6300 NCBI   arginine repressor
gi|257857958 Staphylococcus aureus A6224 NCBI   arginine repressor
gi|257861233 Staphylococcus aureus A5948 NCBI   arginine repressor
gi|257864228 Staphylococcus aureus A5937 NCBI   arginine repressor
gi|258411103 Staphylococcus aureus A9763 NCBI   arginine repressor
gi|258420093 Staphylococcus aureus A9719 NCBI   arginine repressor
gi|258423174 Staphylococcus aureus A9635 NCBI   arginine repressor
gi|258437353 Staphylococcus aureus A9299 NCBI   arginine repressor
gi|258443559 Staphylococcus aureus A8115 NCBI   arginine repressor
gi|258446766 Staphylococcus aureus A6300 NCBI   arginine repressor
gi|258448680 Staphylococcus aureus A6224 NCBI   arginine repressor
gi|258451178 Staphylococcus aureus A5948 NCBI   arginine repressor
gi|258453497 Staphylococcus aureus A5937 NCBI   arginine repressor
gi|259160824 Staphylococcus aureus 930918-3 NCBI   arginine repressor
gi|259162775 Staphylococcus aureus D30 NCBI   arginine repressor
gi|49241899 Staphylococcus aureus subsp. aureus MRSA252 NCBI   arginine repressor
gi|49244800 Staphylococcus aureus subsp. aureus MSSA476 NCBI   arginine repressor
gi|49483770 Staphylococcus aureus subsp. aureus MRSA252 NCBI   arginine repressor
gi|49486357 Staphylococcus aureus subsp. aureus MSSA476 NCBI   arginine repressor
gi|54036744 organism not parsed/found in ncbi nr NCBI   RecName: Full=Arginine repressor
gi|54036745 organism not parsed/found in ncbi nr NCBI   RecName: Full=Arginine repressor
gi|54040816 organism not parsed/found in ncbi nr NCBI   RecName: Full=Arginine repressor
gi|56748579 organism not parsed/found in ncbi nr NCBI   RecName: Full=Arginine repressor
gi|56748591 organism not parsed/found in ncbi nr NCBI   RecName: Full=Arginine repressor
gi|57284663 Staphylococcus aureus subsp. aureus COL NCBI   arginine repressor
gi|57650477 Staphylococcus aureus subsp. aureus COL NCBI   arginine repressor
gi|71152240 organism not parsed/found in ncbi nr NCBI   RecName: Full=Arginine repressor
gi|82656656 Staphylococcus aureus RF122 NCBI   arginine repressor
gi|82751125 Staphylococcus aureus RF122 NCBI   arginine repressor
gi|87126000 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   arginine repressor
gi|87160026 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   arginine repressor
gi|87202885 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   arginine repressor
gi|88195327 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   arginine repressor
img|637093016 Staphylococcus aureus aureus N315 IMG   arginine repressor
img|637100030 Staphylococcus aureus aureus Mu50 IMG   arginine repressor
img|637152306 Staphylococcus aureus aureus COL IMG   arginine repressor
img|637155019 Staphylococcus aureus aureus MRSA252 IMG   arginine repressor
img|637157682 Staphylococcus aureus aureus MSSA476 IMG   arginine repressor
img|637299237 Staphylococcus aureus aureus MW2 IMG   arginine repressor
img|637816337 Staphylococcus aureus RF122 IMG   arginine repressor
img|637888120 Staphylococcus aureus aureus USA300 IMG   arginine repressor
img|637894225 Staphylococcus aureus aureus NCTC 8325 IMG   arginine repressor
img|639107813 Staphylococcus aureus aureus JH1 IMG   Arginine repressor
img|640565925 Staphylococcus aureus aureus JH9 IMG   arginine repressor, ArgR
img|640779694 Staphylococcus aureus aureus JH1 IMG   arginine repressor
img|640795807 Staphylococcus aureus aureus Newman IMG   arginine repressor
img|640904252 Staphylococcus aureus aureus Mu3 IMG   arginine repressor
img|641770882 Staphylococcus aureus aureus USA300_TCH959 IMG   arginine repressor
kegg|saa:SAUSA300_1469 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   arginine repressor
kegg|sab:SAB1393c Staphylococcus aureus RF122 KEGG   arginine repressor
kegg|sac:SACOL1565 Staphylococcus aureus subsp. aureus COL KEGG   arginine repressor
kegg|sae:NWMN_1426 Staphylococcus aureus subsp. aureus Newman KEGG   arginine repressor
kegg|sah:SaurJH1_1612 Staphylococcus aureus subsp. aureus JH1 KEGG   arginine repressor
kegg|saj:SaurJH9_1579 Staphylococcus aureus subsp. aureus JH9 KEGG   arginine repressor
kegg|sam:MW1473 Staphylococcus aureus subsp. aureus MW2 KEGG   arginine repressor
kegg|sao:SAOUHSC_01617 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   arginine repressor
kegg|sar:SAR1598   KEGG   arginine repressor
kegg|sas:SAS1459   KEGG   arginine repressor
kegg|sau:SA1351   KEGG   arginine repressor
kegg|sav:SAV1520   KEGG   arginine repressor
kegg|saw:SAHV_1508 Staphylococcus aureus subsp. aureus Mu3 KEGG   arginine repressor
ref|NP_372044.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   arginine repressor
ref|NP_374634.1 Staphylococcus aureus subsp. aureus N315 RefSeq   arginine repressor
ref|NP_646290.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   arginine repressor
ref|YP_001246948.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   arginine repressor
ref|YP_001316747.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   arginine repressor
ref|YP_001332460.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   arginine repressor
ref|YP_001442098.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   arginine repressor
ref|YP_040994.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   arginine repressor
ref|YP_043578.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   arginine repressor
ref|YP_186406.1 Staphylococcus aureus subsp. aureus COL RefSeq   arginine repressor
ref|YP_416866.1 Staphylococcus aureus RF122 RefSeq   arginine repressor
ref|YP_494165.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   arginine repressor
ref|YP_500131.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   arginine repressor
ref|ZP_03562632.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   arginine repressor
ref|ZP_03564552.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   arginine repressor
ref|ZP_04017772.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   arginine repressor
ref|ZP_04838103.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   arginine repressor
ref|ZP_04867395.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   arginine repressor
ref|ZP_05144908.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   arginine repressor
ref|ZP_05602070.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   arginine repressor
ref|ZP_05604705.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   arginine repressor
ref|ZP_05607324.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   arginine repressor
ref|ZP_05609991.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   arginine repressor
ref|ZP_05612590.1 Staphylococcus aureus subsp. aureus M876 RefSeq   arginine repressor
ref|ZP_05642576.1 Staphylococcus aureus A9781 RefSeq   arginine repressor
ref|ZP_05681383.1 Staphylococcus aureus A9763 RefSeq   arginine repressor
ref|ZP_05683048.1 Staphylococcus aureus A9719 RefSeq   arginine repressor
ref|ZP_05686067.1 Staphylococcus aureus A9635 RefSeq   arginine repressor
ref|ZP_05689337.1 Staphylococcus aureus A9299 RefSeq   arginine repressor
ref|ZP_05691898.1 Staphylococcus aureus A8115 RefSeq   arginine repressor
ref|ZP_05694920.1 Staphylococcus aureus A6300 RefSeq   arginine repressor
ref|ZP_05696792.1 Staphylococcus aureus A6224 RefSeq   arginine repressor
ref|ZP_05699213.1 Staphylococcus aureus A5948 RefSeq   arginine repressor
ref|ZP_05701475.1 Staphylococcus aureus A5937 RefSeq   arginine repressor
sp|A5IT49 Staphylococcus aureus (strain JH9) SwissProt   Arginine repressor
sp|A6QH66 Staphylococcus aureus (strain Newman) SwissProt   Arginine repressor
sp|A6U1Z2 Staphylococcus aureus (strain JH1) SwissProt   Arginine repressor
sp|A7X2P6 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   Arginine repressor
sp|ARGR_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Arginine repressor
sp|ARGR_STAA2 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Arginine repressor
sp|ARGR_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Arginine repressor
sp|ARGR_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Arginine repressor
sp|ARGR_STAA9 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Arginine repressor
sp|ARGR_STAAB organism not parsed/found in ncbi nr SwissProt   RecName: Full=Arginine repressor
sp|ARGR_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Arginine repressor
sp|ARGR_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=Arginine repressor
sp|ARGR_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=Arginine repressor
sp|ARGR_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=Arginine repressor
sp|ARGR_STAAR organism not parsed/found in ncbi nr SwissProt   RecName: Full=Arginine repressor
sp|ARGR_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=Arginine repressor
sp|ARGR_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=Arginine repressor
sp|P63579 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   Arginine repressor
sp|P63580 Staphylococcus aureus (strain N315) SwissProt   Arginine repressor
sp|P63581 Staphylococcus aureus (strain MW2) SwissProt   Arginine repressor
sp|Q2FGL3 Staphylococcus aureus (strain USA300) SwissProt   Arginine repressor
sp|Q2FY49 Staphylococcus aureus (strain NCTC 8325) SwissProt   Arginine repressor
sp|Q2YYC1 Staphylococcus aureus (strain bovine RF122 / ET3-1) SwissProt   Arginine repressor
sp|Q5HFQ1 Staphylococcus aureus (strain COL) SwissProt   Arginine repressor
sp|Q6G945 Staphylococcus aureus (strain MSSA476) SwissProt   Arginine repressor
sp|Q6GGH8 Staphylococcus aureus (strain MRSA252) SwissProt   Arginine repressor
tr|C2GC33 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   Arginine repressor
tr|C5PZS7 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Arginine repressor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
26 fig|93061.5.peg.1470 DNA repair protein RecN
16 fig|93061.5.peg.1472 Octaprenyl diphosphate synthase (EC 2.5.1.90) / Dimethylallyltransferase (EC 2.5.1.1) / (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.29)
11 fig|93061.5.peg.1473 Exodeoxyribonuclease VII small subunit (EC 3.1.11.6)
11 fig|93061.5.peg.1474 Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search