The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1402: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage HNH endonuclease
Translate Function Assignments



Context on contig NC_007795 from base 1482837 to 1493469 (10633 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1397 1484000 1482837 1164 -   8     Phage major capsid protein # Fam0068 locus|SAOUHSC_01535, protein_id|YP_500051.1, gi|88195248, geneID|3920637
1398 1484785 1484012 774 - 11 20     Phage head, head-tail preconnector protease C locus|SAOUHSC_01536, protein_id|YP_500052.1, gi|88195249, geneID|3920638
1399 1486007 1484769 1239 - -17 11     Phage portal protein locus|SAOUHSC_01537, protein_id|YP_500053.1, gi|88195250, geneID|3920580
1400 1487703 1486012 1692 - 4 19     Phage terminase large subunit locus|SAOUHSC_01538, protein_id|YP_500054.1, gi|88195251, geneID|3920581
1401 1487998 1487693 306 - -11 6     Phage terminase small subunit locus|SAOUHSC_01539, protein_id|YP_500055.1, gi|88195252, geneID|3920582
1402 1488434 1488120 315 - 121       Phage HNH endonuclease locus|SAOUHSC_01540, protein_id|YP_500056.1, gi|88195253, geneID|3920583
1403 1489028 1488591 438 - 156         Phage regulatory protein locus|SAOUHSC_01541, protein_id|YP_500057.1, gi|88195254, geneID|3920584
1404 1490399 1489041 1359 - 12         DNA helicase, phage-associated locus|SAOUHSC_01542, protein_id|YP_500058.1, gi|88195255, geneID|3920585
1405 1490679 1490389 291 - -11         Phage protein locus|SAOUHSC_01543, protein_id|YP_500059.1, gi|88195256, geneID|3920586
1406 1491169 1491020 150 - 340         DNA primase, phage associated locus|SAOUHSC_01545, protein_id|YP_500061.1, gi|88195258, geneID|3920588
1407 1491416 1491243 174 - 73         Phage primase locus|SAOUHSC_01546, protein_id|YP_500062.1, gi|88195259, geneID|3920589
1408 1493469 1491472 1998 - 55         DNA primase, phage associated # P4-type locus|SAOUHSC_01547, protein_id|YP_500063.1, gi|88195260, geneID|3920590

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1402 Phage HNH endonuclease
MTKHNNIYKHGRKSYQYDWFYHSKAWKKLREIALDRDNHLCQMCLREDIVTDANIVHHII
YVDEDFNKALDLDNLMSVCYSCHNKIHANDNDKSNLKKIRVLKI

MD5 = ca694c36c46aa22bfbedbdc2a0397310


  DNA Sequence

>fig|93061.5.peg.1402 Phage HNH endonuclease
atgaccaagcataataacatttataagcatggtcgtaagtcatatcaatacgattggttc
tatcattcaaaagcatggaagaagttaagagagatagcattagatagggataatcatctt
tgtcaaatgtgtttacgtgaagacatagtaacagatgcaaacatagtgcatcatattatt
tatgttgatgaagattttaataaagctttagacttagataatttgatgtcagtttgttat
agctgtcataacaaaattcatgcaaatgataatgacaaaagtaatcttaagaaaattaga
gtattaaaaatttaa


  DNA with Flanking Sequence

>fig|93061.5.peg.1402 Phage HNH endonuclease
gattgagaatggagatacttaacccaacgaaagagctagacactaacattgtgtatggac
cgttgcaaaaaggtgaaccagttagaacaactgaactaatggcaacaaggttattgacta
ataagatgttacgaaacctagaagaaatggtcgaagcagttgaaagtgaatacttaaagt
tacctgaagatcataagaaagtaattaggctaaagtattggaatagagataagaagctaa
agatagagcaaataggagatgcatgtcacatgcatcgtaatacagttactactatacgaa
agaactttgttaaagcggtagcgtatcatgcaggtatcaaataacattgtgcaaagattg
tgcaaaaggcctacaaatctgtagtaatatgatagtatcggaaagatgtataaagttatc
taaaagttatacgacacaagtacacgaggcacatcgctatgcggtgtgtcttttgttatg
caatcaaagaggtgtaagagatgaccaagcataataacatttataagcatggtcgtaagt
catatcaatacgattggttctatcattcaaaagcatggaagaagttaagagagatagcat
tagatagggataatcatctttgtcaaatgtgtttacgtgaagacatagtaacagatgcaa
acatagtgcatcatattatttatgttgatgaagattttaataaagctttagacttagata
atttgatgtcagtttgttatagctgtcataacaaaattcatgcaaatgataatgacaaaa
gtaatcttaagaaaattagagtattaaaaatttaaataaaaaaataatttatttttatag
ccccctacccatcggcttaaaatgttttttcgacgggtaccggcgggggcccttcgcttg
caacgcggataaacttttatgaaagggggtctttatatgaaattaacaaaaaaacagctg
aaagaatatatagaggattataaaaaatctgatgacatattaattaatttgtatatagaa
acgtatgaattttattgtcggttaagagatgaacttaaaaatagtgatttgatgatagag
catacaaacaaggctggtgcgagcaatattgttaagaatccattaagcatagaactgaca
aaaacagttcaaacactaaataacttactcaagtctatgggtttaactgcagcacaaaga
aaaaagatagttcaagaagaaggtggattcggtgactattaaagttttaaatgaaccttc
accaaaactattaacaacatggtatgcagagcaagtcactcaagggaaaataaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003676       F:nucleic acid binding
GO:0004519       F:endonuclease activity
cmr|NT05SA1371 Staphylococcus aureus NCTC 8325     phage endonuclease
fig|186152.1.peg.28 Staphylococcus aureus phage phi 12 FIG   Phage HNH endonuclease
fig|505321.3.peg.968 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Phage HNH endonuclease
fig|680649.3.peg.1682 Staphylococcus aureus subsp. aureus MR1 FIG   Phage HNH endonuclease
fig|762962.3.peg.530 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Phage HNH endonuclease
fig|93061.3.peg.1448 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage HNH endonuclease
gb|AAL82309.1 Staphylococcus aureus phage phi 12     SLT orf 104b-like protein
gb|ABD30621.1 Staphylococcus aureus subsp. aureus NCTC 8325     bacteriophage L54a, HNH endonuclease family protein
gi|18920569 Staphylococcus aureus phage phi 12 NCBI   SLT orf 104b-like protein
gi|253315478 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   bacteriophage L54a, HNH endonuclease family protein
gi|29028645 Staphylococcus phage phi 12 NCBI   SLT orf 104b-like protein
gi|87202811 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   bacteriophage L54a, HNH endonuclease family protein
gi|88195253 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   bacteriophage L54a, HNH endonuclease family protein
img|637894150 Staphylococcus aureus aureus NCTC 8325 IMG   bacteriophage L54a, HNH endonuclease family protein
img|638297076 Staphylococcus aureus phage phi 12 IMG   SLT orf 104b-like protein
kegg|sao:SAOUHSC_01540 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   bacteriophage L54a, HNH endonuclease family protein
ref|NP_803334.1 Staphylococcus phage phi 12 RefSeq   SLT orf 104b-like protein
ref|YP_500056.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   bacteriophage L54a, HNH endonuclease family protein
ref|ZP_04838691.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   bacteriophage L54a, HNH endonuclease family protein
tr|Q2FYC4 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Bacteriophage L54a, HNH endonuclease family protein
tr|Q8SDQ2 Staphylococcus phage phi 12 TrEMBL   SLT orf 104b-like protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
8 fig|93061.5.peg.1397 Phage major capsid protein # Fam0068
20 fig|93061.5.peg.1398 Phage head, head-tail preconnector protease C
11 fig|93061.5.peg.1399 Phage portal protein
19 fig|93061.5.peg.1400 Phage terminase large subunit
6 fig|93061.5.peg.1401 Phage terminase small subunit


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search