The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1396: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Phage DNA packaging protein
Translate Function Assignments



Context on contig NC_007795 from base 1473307 to 1487998 (14692 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1388 1479507 1473307 6201 -       1: 1   Phage tail, tail length tape-measure protein locus|SAOUHSC_01525, protein_id|YP_500042.1, gi|88195239, geneID|3920628
1389 1479679 1479521 159 - 13         Phage protein locus|SAOUHSC_01526, protein_id|YP_500043.1, gi|88195240, geneID|3920629
1390 1480071 1479721 351 - 41         Phage baseplate assembly protein locus|SAOUHSC_01527, protein_id|YP_500044.1, gi|88195241, geneID|3920630
1391 1480584 1480129 456 - 57     1: 1   Phage A118 gp13 protein homolog locus|SAOUHSC_01528, protein_id|YP_500045.1, gi|88195242, geneID|3920631
1392 1481317 1480676 642 - 91     1: 1   Phage major tail protein locus|SAOUHSC_01529, protein_id|YP_500046.1, gi|88195243, geneID|3920632
1393 1481747 1481352 396 - 34         Phage protein locus|SAOUHSC_01530, protein_id|YP_500047.1, gi|88195244, geneID|3920633
1394 1482149 1481748 402 - 0         Phage protein locus|SAOUHSC_01531, protein_id|YP_500048.1, gi|88195245, geneID|3920634
1395 1482478 1482146 333 - -4         Phage protein locus|SAOUHSC_01532, protein_id|YP_500049.1, gi|88195246, geneID|3920635
1396 1482768 1482490 279 - 11         Phage DNA packaging protein locus|SAOUHSC_01533, protein_id|YP_500050.1, gi|88195247, geneID|3920636
1397 1484000 1482837 1164 - 68         Phage major capsid protein # Fam0068 locus|SAOUHSC_01535, protein_id|YP_500051.1, gi|88195248, geneID|3920637
1398 1484785 1484012 774 - 11         Phage head, head-tail preconnector protease C locus|SAOUHSC_01536, protein_id|YP_500052.1, gi|88195249, geneID|3920638
1399 1486007 1484769 1239 - -17         Phage portal protein locus|SAOUHSC_01537, protein_id|YP_500053.1, gi|88195250, geneID|3920580
1400 1487703 1486012 1692 - 4         Phage terminase large subunit locus|SAOUHSC_01538, protein_id|YP_500054.1, gi|88195251, geneID|3920581
1401 1487998 1487693 306 - -11         Phage terminase small subunit locus|SAOUHSC_01539, protein_id|YP_500055.1, gi|88195252, geneID|3920582

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.5.peg.1396 Phage DNA packaging protein
MSLEEIKLWLRIDYNFENDLIEGLIQSAKSELLLSGVPDYDKDDLEYPLFCTAIKYIIAR
DYESRGYSNDQSRSKVFNEKGLQKMILKLKKW

MD5 = 98603d6d47bb27fcb031fa12eda4eb2e


  DNA Sequence

>fig|93061.5.peg.1396 Phage DNA packaging protein
atgagtttagaagaaattaaattgtggttgagaattgactataatttcgaaaatgattta
attgaaggtctcattcaatcggctaagtctgaattactattaagtggggttccagattat
gacaaagatgacttggaatacccgcttttttgtacagcgattaaatatatcattgcaaga
gattatgaaagtcgtggatactcaaatgaccaatctagaagcaaggtgtttaatgaaaaa
ggattgcaaaaaatgattttgaaattaaaaaagtggtag


  DNA with Flanking Sequence

>fig|93061.5.peg.1396 Phage DNA packaging protein
ttagaacacatgtcattttataatggatctgttaaagaagttgagggagcagacatgtat
gatgctattattaacgctttagcagatttacatgaagattatcgtgataacgcaacaatt
tatatgcgatatgcagattatgtcaaaattattagtgttctttcaaatggaacaacaaat
ttctttgacacaccagcagaaaaagtatttggcaaaccagtagtatttacagatgcagca
gttaaacctattgtgggagatttcaattattttggaattaactatgatggaacaacttat
gacactgataaagatgttaaaaaaggcgaatatttgtttgtattaacagcatggtatgat
cagcaacgtacattagacagtgcattcagaattgcaaaagcaaaagaaaatacaggtcca
ttacccagctaagccccaaaaggttaatgtaacagctaaggctaaatcagctgtaatatc
agccgaataggggtgatgaaatgagtttagaagaaattaaattgtggttgagaattgact
ataatttcgaaaatgatttaattgaaggtctcattcaatcggctaagtctgaattactat
taagtggggttccagattatgacaaagatgacttggaatacccgcttttttgtacagcga
ttaaatatatcattgcaagagattatgaaagtcgtggatactcaaatgaccaatctagaa
gcaaggtgtttaatgaaaaaggattgcaaaaaatgattttgaaattaaaaaagtggtagg
tgatttttaaatggaatttaatgaatttaaagatcgcgcgtatttttttcaatatataaa
caaaggaccatatccagatgaagaggaaaaaatgaaattgtatagttgcttttgtaaaat
ttataatccttctatgaaagatagagaaattttaaaagcgactgaatcaaaatcaggatt
aaccataattgtcaggtcttctaaaactgaatatctaccacaaacaaatcacttagttaa
aattgacagtgcattatattccgataaattattcaacattgtagaaataagaattgatac
accagatattggctataatacagtggttttatcagaaaaatgagtgtagaaattaaaggg
atacctgaagtgttgaataaattagaatcggtatacggtaaacaagcaatgcaggctaag
agtgataaagctttaaatgaagcatctgaattttttataaaggctttaaagaaagagttc
gagagctttaaagatacgg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT03SA1526 Staphylococcus aureus MW2     uncharacterized phage protein (possible DNA packaging)
cmr|NT05SA1365 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
cmr|NT08SA1479 Staphylococcus aureus subsp. aureus MRSA252     uncharacterized phage protein (possible DNA packaging)
cmr|NT09SA0934 Staphylococcus aureus subsp. aureus MSSA476     uncharacterized phage protein (possible DNA packaging)
cmr|SACOL0371 Staphylococcus aureus subsp. aureus COL     prophage L54a, DNA packaging protein, putative
cmr|SAUSA300_1400 Staphylococcus aureus subsp. aureus USA300-FPR3757     phiSLT ORF92-like protein, uncharacterized phage protein (possible DNA packaging)
dbj|BAB21736.1 Staphylococcus phage phiSLT     unnamed protein product
dbj|BAB95262.1 Staphylococcus aureus subsp. aureus MW2     hypothetical protein
dbj|BAG74408.1 Staphylococcus phage phi2958PVL     hypothetical protein
emb|CAG40513.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   hypothetical phage protein
emb|CAG42712.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   hypothetical phage protein
fig|130478.1.peg.43 Staphylococcus aureus temperate phage phiSLT FIG   Phage DNA packaging protein
fig|196620.1.peg.1397 Staphylococcus aureus subsp. aureus MW2 FIG   Phage DNA packaging protein
fig|196620.5.peg.1463 Staphylococcus aureus subsp. aureus MW2 FIG   Phage DNA packaging protein
fig|282458.1.peg.1434 Staphylococcus aureus subsp. aureus MRSA252 FIG   Phage DNA packaging protein
fig|282458.4.peg.1519 Staphylococcus aureus subsp. aureus MRSA252 FIG   Phage DNA packaging protein
fig|282459.1.peg.930 Staphylococcus aureus subsp. aureus MSSA476 FIG   Phage DNA packaging protein
fig|282459.5.peg.972 Staphylococcus aureus subsp. aureus MSSA476 FIG   Phage DNA packaging protein
fig|320837.3.peg.9 Bacteriophage 42e FIG   Phage DNA packaging protein
fig|320839.3.peg.7 Bacteriophage 47 FIG   Phage DNA packaging protein
fig|367830.3.peg.1907 Staphylococcus aureus subsp. aureus USA300 FIG   Phage DNA packaging protein
fig|430796.2.peg.39 Viruses Staphylococcus phage phi2958PVL Viruses. FIG   Phage DNA packaging protein
fig|445516.2.peg.49 Viruses Staphylococcus phage tp310-2 Viruses. FIG   Phage DNA packaging protein
fig|451515.3.peg.1531 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Phage DNA packaging protein
fig|451516.9.peg.1536 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Phage DNA packaging protein
fig|452948.4.peg.2149 Staphylococcus aureus 930918-3 FIG   Phage DNA packaging protein
fig|505321.3.peg.961 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Phage DNA packaging protein
fig|548470.3.peg.319 Staphylococcus aureus subsp. aureus MN8 FIG   Phage DNA packaging protein
fig|548473.3.peg.1827 Staphylococcus aureus subsp. aureus TCH60 FIG   Phage DNA packaging protein
fig|548475.3.peg.435 Staphylococcus aureus subsp. aureus TCH70 FIG   Phage DNA packaging protein
fig|553565.3.peg.2326 Staphylococcus aureus A5937 FIG   Phage DNA packaging protein
fig|553568.3.peg.1162 Staphylococcus aureus A6224 FIG   Phage DNA packaging protein
fig|553571.3.peg.605 Staphylococcus aureus A6300 FIG   Phage DNA packaging protein
fig|553577.3.peg.2618 Staphylococcus aureus A8796 FIG   Phage DNA packaging protein
fig|553580.3.peg.2693 Staphylococcus aureus A8819 FIG   Phage DNA packaging protein
fig|553581.3.peg.75 Staphylococcus aureus A9299 FIG   Phage DNA packaging protein
fig|553588.3.peg.622 Staphylococcus aureus A9719 FIG   Phage DNA packaging protein
fig|553590.4.peg.533 Staphylococcus aureus A9754 FIG   Phage DNA packaging protein
fig|553594.3.peg.788 Staphylococcus aureus A9765 FIG   Phage DNA packaging protein
fig|575610.2.peg.42 Siphoviridae Staphylococcus phage phiSauS-IPLA35 FIG   Phage DNA packaging protein
fig|585145.3.peg.1706 Staphylococcus aureus subsp. aureus 65-1322 FIG   Phage DNA packaging protein
fig|585148.3.peg.1029 Staphylococcus aureus subsp. aureus Btn1260 FIG   Phage DNA packaging protein
fig|585151.3.peg.1437 Staphylococcus aureus subsp. aureus C427 FIG   Phage DNA packaging protein
fig|585153.3.peg.291 Staphylococcus aureus subsp. aureus E1410 FIG   Phage DNA packaging protein
fig|585154.3.peg.1136 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Phage DNA packaging protein
fig|585160.3.peg.987 Staphylococcus aureus subsp. aureus WBG10049 FIG   Phage DNA packaging protein
fig|644279.4.peg.1601 Staphylococcus aureus subsp. aureus 132 FIG   Phage DNA packaging protein
fig|680649.3.peg.1688 Staphylococcus aureus subsp. aureus MR1 FIG   Phage DNA packaging protein
fig|681288.4.peg.1998 Staphylococcus aureus subsp. aureus ED98 FIG   Phage DNA packaging protein
fig|762962.3.peg.536 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Phage DNA packaging protein
fig|93061.3.peg.1442 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Phage DNA packaging protein
fig|93062.19.peg.357 Staphylococcus aureus subsp. aureus COL FIG   Phage DNA packaging protein
fig|93062.4.peg.830 Staphylococcus aureus subsp. aureus COL FIG   Phage DNA packaging protein
gb|AAW37578.1 Staphylococcus aureus subsp. aureus COL     prophage L54a, DNA packaging protein, putative
gb|AAX91162.1 Bacteriophage 42e     ORF055
gb|AAX91235.1 Bacteriophage 47     ORF046
gb|ABD22898.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     phiSLT ORF92-like protein, uncharacterized phage protein (possible DNA packaging)
gb|ABD30615.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical phage protein
gb|ABS87511.1 Staphylococcus phage tp310-2     hypothetical protein
gb|ABX29458.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     possible DNA packaging protein
gb|ACJ64631.1 Staphylococcus phage phiSauS-IPLA35     gp42
gb|EEI95132.1 Staphylococcus aureus subsp. aureus MN8     DNA packaging protein
gb|EEJ61802.1 Staphylococcus aureus subsp. aureus TCH60     DNA packaging protein
gb|EES54543.1 Staphylococcus aureus subsp. aureus TCH70     DNA packaging protein
gb|EEV06558.1 Staphylococcus aureus subsp. aureus 65-1322     DNA packaging phage protein
gb|EEV13467.1 Staphylococcus aureus subsp. aureus E1410     conserved hypothetical protein
gb|EEV68123.1 Staphylococcus aureus A9719     DNA packaging protein
gb|EEV73872.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV78550.1 Staphylococcus aureus A6300     DNA packaging protein
gb|EEV80763.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV85019.1 Staphylococcus aureus A5937     phage protein (DNA packaging)
gi|12697864 Staphylococcus phage phiSLT NCBI   unnamed protein product
gi|12719434 Staphylococcus phage phiSLT NCBI   hypothetical protein phiSLTp43
gi|154818084 Staphylococcus phage tp310-2 NCBI   hypothetical protein
gi|156603998 Staphylococcus phage tp310-2 NCBI   hypothetical protein SPTP3102_gp49
gi|160368487 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   possible DNA packaging protein
gi|161509678 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   DNA packaging protein
gi|208973092 Staphylococcus phage phi2958PVL NCBI   hypothetical protein
gi|209363591 Staphylococcus phage phi2958PVL NCBI   hypothetical protein phi2958PVL_gp39
gi|21204566 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein
gi|21283126 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW1397
gi|215260501 Staphylococcus phage phiSauS-IPLA35 NCBI   gp42
gi|215401150 Staphylococcus phage phiSauS-IPLA35 NCBI   putative DNA packaging protein
gi|227245373 Staphylococcus aureus subsp. aureus MN8 NCBI   DNA packaging protein
gi|227558241 Staphylococcus aureus subsp. aureus MN8 NCBI   DNA packaging protein
gi|227852004 Staphylococcus aureus subsp. aureus TCH60 NCBI   DNA packaging protein
gi|227900044 Staphylococcus aureus subsp. aureus TCH60 NCBI   DNA packaging protein
gi|251801886 Staphylococcus aureus subsp. aureus TCH70 NCBI   DNA packaging protein
gi|251814438 Staphylococcus aureus subsp. aureus TCH70 NCBI   DNA packaging protein
gi|253315473 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   phiSLT ORF92-like protein, uncharacterized phage protein ( DNA packaging)
gi|257275071 Staphylococcus aureus subsp. aureus 65-1322 NCBI   DNA packaging phage protein
gi|257283335 Staphylococcus aureus subsp. aureus E1410 NCBI   conserved hypothetical protein
gi|257428230 Staphylococcus aureus subsp. aureus 65-1322 NCBI   DNA packaging phage protein
gi|257432456 Staphylococcus aureus subsp. aureus E1410 NCBI   conserved hypothetical protein
gi|257843721 Staphylococcus aureus A9719 NCBI   DNA packaging protein
gi|257849913 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257855617 Staphylococcus aureus A6300 NCBI   DNA packaging protein
gi|257857872 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257862248 Staphylococcus aureus A5937 NCBI   phage protein (DNA packaging)
gi|258420296 Staphylococcus aureus A9719 NCBI   DNA packaging protein
gi|258427135 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258445570 Staphylococcus aureus A6300 NCBI   DNA packaging protein
gi|258448835 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258455560 Staphylococcus aureus A5937 NCBI   phage protein (DNA packaging)
gi|49241821 Staphylococcus aureus subsp. aureus MRSA252 NCBI   hypothetical phage protein
gi|49244285 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical phage protein
gi|49483692 Staphylococcus aureus subsp. aureus MRSA252 NCBI   hypothetical protein SAR1515
gi|49485842 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS0936
gi|57285484 Staphylococcus aureus subsp. aureus COL NCBI   prophage L54a, DNA packaging protein, putative
gi|57651298 Staphylococcus aureus subsp. aureus COL NCBI   prophage L54a, DNA packaging protein, putative
gi|62636051 Bacteriophage 42e NCBI   ORF055
gi|62636124 Bacteriophage 47 NCBI   ORF046
gi|66395558 Staphylococcus phage 42E NCBI   ORF055
gi|66395700 Staphylococcus phage 47 NCBI   ORF046
gi|87128384 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   phiSLT ORF92-like protein, uncharacterized phage protein (possible DNA packaging)
gi|87162410 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   phiSLT ORF92-like protein, uncharacterized phage protein ( DNA packaging)
gi|87202805 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical phage protein
gi|88195247 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01533
img|637151146 Staphylococcus aureus aureus COL IMG   prophage L54a, DNA packaging protein, putative
img|637154941 Staphylococcus aureus aureus MRSA252 IMG   hypothetical protein
img|637157164 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637299161 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637888052 Staphylococcus aureus aureus USA300 IMG   phiSLT ORF92-like protein, uncharacterized phage protein (possible DNA packaging)
img|637894144 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|638286629 Staphylococcus aureus temperate phage phiSLT IMG   hypothetical protein
img|638314280 Bacteriophage 42e IMG   ORF055
img|638314426 Bacteriophage 47 IMG   ORF046
img|641210021 Staphylococcus phage tp310-2 provirus IMG   hypothetical protein
img|641309410 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   possible DNA packaging protein
img|641771419 Staphylococcus aureus aureus USA300_TCH959 IMG   uncharacterized phage protein
kegg|saa:SAUSA300_1400 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   phiSLT ORF92-like protein, uncharacterized phage protein ( DNA packaging)
kegg|sac:SACOL0371 Staphylococcus aureus subsp. aureus COL KEGG   prophage L54a, DNA packaging protein, putative
kegg|sam:MW1397 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_01533 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sar:SAR1515   KEGG   hypothetical protein
kegg|sas:SAS0936   KEGG   hypothetical protein
kegg|sax:USA300HOU_1449 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   DNA packaging protein
ref|NP_075505.1 Staphylococcus phage phiSLT RefSeq   hypothetical protein phiSLTp43
ref|NP_646214.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW1397
ref|YP_001429944.1 Staphylococcus phage tp310-2 RefSeq   hypothetical protein SPTP3102_gp49
ref|YP_001575337.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   DNA packaging protein
ref|YP_002268009.1 Staphylococcus phage phi2958PVL RefSeq   hypothetical protein phi2958PVL_gp39
ref|YP_002332405.1 Staphylococcus phage phiSauS-IPLA35 RefSeq   putative DNA packaging protein
ref|YP_040916.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   hypothetical protein SAR1515
ref|YP_043063.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS0936
ref|YP_185263.1 Staphylococcus aureus subsp. aureus COL RefSeq   prophage L54a, DNA packaging protein, putative
ref|YP_239861.1 Staphylococcus phage 42E RefSeq   ORF055
ref|YP_240007.1 Staphylococcus phage 47 RefSeq   ORF046
ref|YP_494097.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   phiSLT ORF92-like protein, uncharacterized phage protein ( DNA packaging)
ref|YP_500050.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01533
ref|ZP_03988288.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   DNA packaging protein
ref|ZP_04017849.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   DNA packaging protein
ref|ZP_04828911.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   DNA packaging protein
ref|ZP_04838686.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   phiSLT ORF92-like protein, uncharacterized phage protein ( DNA packaging)
ref|ZP_05604628.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   DNA packaging phage protein
ref|ZP_05608819.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   conserved hypothetical protein
ref|ZP_05683243.1 Staphylococcus aureus A9719 RefSeq   DNA packaging protein
ref|ZP_05688057.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05693752.1 Staphylococcus aureus A6300 RefSeq   DNA packaging protein
ref|ZP_05696945.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05703517.1 Staphylococcus aureus A5937 RefSeq   phage protein (DNA packaging)
tr|A7TWJ4 Staphylococcus phage tp310-2 TrEMBL   Putative uncharacterized protein
tr|A8Z283 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Possible DNA packaging protein
tr|B5WZP5 Staphylococcus phage phi2958PVL TrEMBL   Putative uncharacterized protein
tr|B7T0J3 Staphylococcus phage phiSauS-IPLA35 TrEMBL   Gp42
tr|C2GAX8 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   DNA packaging protein
tr|C2K848 Staphylococcus aureus subsp. aureus MN8 TrEMBL   DNA packaging protein
tr|C5QJE5 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   DNA packaging protein
tr|Q2FGT1 Staphylococcus aureus (strain USA300) TrEMBL   PhiSLT ORF92-like protein, uncharacterized phage protein (Possible DNA packaging)
tr|Q2G2S3 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Conserved hypothetical phage protein
tr|Q4ZCL9 Staphylococcus phage 47 TrEMBL   ORF046
tr|Q4ZD15 Staphylococcus phage 42E TrEMBL   ORF055
tr|Q5HIZ4 Staphylococcus aureus (strain COL) TrEMBL   Prophage L54a, DNA packaging protein, putative
tr|Q6GAL0 Staphylococcus aureus (strain MSSA476) TrEMBL   Hypothetical phage protein
tr|Q6GGQ6 Staphylococcus aureus (strain MRSA252) TrEMBL   Hypothetical phage protein
tr|Q8NWK1 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW1397
tr|Q9B0D9 Staphylococcus phage phiSLT TrEMBL   Orf92


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search