The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.5.peg.1144: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: SSU ribosomal protein S15p (S13e)
Translate Function Assignments



Context on contig NC_007795 from base 1196412 to 1208721 (12310 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1140 1196412 1198529 2118 +   26 5: 14 3 4 5 1   Translation initiation factor 2 gene_name|infB, locus|SAOUHSC_01246, protein_id|YP_499779.1, gi|88194979, geneID|3919977
1141 1198873 1199265 393 + 343 39 4: 3 12 5 1   Ribosome-binding factor A gene_name|rbfA, locus|SAOUHSC_01247, protein_id|YP_499780.1, gi|88194980, geneID|3919978
1142 1199434 1200351 918 + 168 30 2: 11 1   tRNA pseudouridine synthase B (EC 4.2.1.70) locus|SAOUHSC_01248, protein_id|YP_499781.1, gi|88194981, geneID|3919979
1143 1200366 1201337 972 + 14 10 3: 13 6 15   FMN adenylyltransferase (EC 2.7.7.2) / Riboflavin kinase (EC 2.7.1.26) locus|SAOUHSC_01249, protein_id|YP_499782.1, gi|88194982, geneID|3919980
1144 1201452 1201721 270 + 114   2: 19 7   SSU ribosomal protein S15p (S13e) gene_name|rpsO, locus|SAOUHSC_01250, protein_id|YP_499783.1, gi|88194983, geneID|3919981
1145 1202091 1204187 2097 + 369 48 3: 4 17 2 dlit(10079526) Polyribonucleotide nucleotidyltransferase (EC 2.7.7.8) locus|SAOUHSC_01251, protein_id|YP_499784.1, gi|88194984, geneID|3919982
1146 1204423 1206096 1674 + 235 4 2: 8 2   Ribonuclease J2 (endoribonuclease in RNA processing) locus|SAOUHSC_01252, protein_id|YP_499785.1, gi|88194985, geneID|3919983
1147 1206352 1208721 2370 + 255     5: 10 9 2 16 18   Cell division protein FtsK locus|SAOUHSC_01253, protein_id|YP_499786.1, gi|88194986, geneID|3919984

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Single-copy_ribosomal_proteins gjo SSU ribosomal protein S15p (S13e)
Ribosome_SSU_bacterial gjo SSU ribosomal protein S15p (S13e)


  Protein Sequence

>fig|93061.5.peg.1144 SSU ribosomal protein S15p (S13e)
MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMV
GRRRHLLNYLRSKDIQRYRELIKSLGIRR

MD5 = 85eb0f926fa273a7e5b5a2c74d0685f1


  DNA Sequence

>fig|93061.5.peg.1144 SSU ribosomal protein S15p (S13e)
atggcaatttcacaagaacgtaaaaacgaaatcattaaagaataccgtgtacacgaaact
gatactggttcaccagaagtacaaatcgctgtacttactgcagaaatcaacgcagtaaac
gaacacttacgtacacacaaaaaagaccaccattcacgtcgtggattattaaaaatggta
ggtcgtcgtagacatttattaaactacttacgtagtaaagatattcaacgttaccgtgaa
ttaattaaatcacttggtatccgtcgttaa


  DNA with Flanking Sequence

>fig|93061.5.peg.1144 SSU ribosomal protein S15p (S13e)
aaggtgaaaaaaggggaagaactattggcttcccaacagctaacattcaacctagtgatg
attatttgttacctcgtaaaggtgtttatgctgttagtattgaaatcggcactgaaaata
aattatatcgaggggtagctaacataggtgtaaagccaacatttcatgatcctaacaaag
cagaagttgtcatcgaagtgaatatctttgactttgaggataatatttatggtgaacgag
tgaccgtgaattggcatcatttcttacgtcctgagattaaatttgatggtatcgacccat
tagttaaacaaatgaacgatgataaatcgcgtgctaaatatttattagcagttgattttg
gtgatgaagtagcttataatatctagagttgcgtatagttatataaacaatctataccac
acctttttcttagtaggtcgaatctccaacgcctaactcggattaaggagtattcaaaca
ttttaaggaggaaattgattatggcaatttcacaagaacgtaaaaacgaaatcattaaag
aataccgtgtacacgaaactgatactggttcaccagaagtacaaatcgctgtacttactg
cagaaatcaacgcagtaaacgaacacttacgtacacacaaaaaagaccaccattcacgtc
gtggattattaaaaatggtaggtcgtcgtagacatttattaaactacttacgtagtaaag
atattcaacgttaccgtgaattaattaaatcacttggtatccgtcgttaatcttaatata
acgtctttgaggttggggcatatttatgttccaaccttaatttatattaaaaaagctttt
tacaaatattaacatttattatatgttaagctaatattgagtgaataataaggttacaat
gagataaagatgatataagtacacctagagtaataatcaagatattaaaaataaagtatg
tttttttaaaaaatataacttatatttatactgataagggtgggacgataagtctatttt
gtaaataatagatggatatcccgctctctttttttccaattcaatattttataactaata
ttaaaatacgataataaatgatatgatataactattagattcaagagaggagatttataa
tgtctcaagaaaagaaagtttttaaaactgaatgggcaggaagatctttaacgattgaaa
cagggcaattagctaaacaagcaaatggcgctgtattggttcgttatggagatacagtcg
tgttatcgac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003735       F:structural constituent of ribosome
GO:0005840       C:ribosome
GO:0006412       P:translation
GO:0019843       F:rRNA binding
cmr|NT01SA1213 Staphylococcus aureus N315     ribosomal protein S15
cmr|NT02SA1261 Staphylococcus aureus Mu50     ribosomal protein S15
cmr|NT03SA1260 Staphylococcus aureus MW2     ribosomal protein S15
cmr|NT05SA1122 Staphylococcus aureus NCTC 8325     ribosomal protein S15
cmr|NT08SA1220 Staphylococcus aureus subsp. aureus MRSA252     ribosomal protein S15
cmr|NT09SA1199 Staphylococcus aureus subsp. aureus MSSA476     ribosomal protein S15
cmr|NT11SA1150 Staphylococcus aureus RF122     ribosomal protein S15
cmr|SACOL1292 Staphylococcus aureus subsp. aureus COL     ribosomal protein S15
cmr|SAUSA300_1166 Staphylococcus aureus subsp. aureus USA300-FPR3757     30S ribosomal protein S15
dbj|BAB42368.1 Staphylococcus aureus subsp. aureus N315     30Sribosomal protein S15
dbj|BAB57435.1 Staphylococcus aureus subsp. aureus Mu50     30Sribosomal protein S15
dbj|BAB95021.1 Staphylococcus aureus subsp. aureus MW2     30Sribosomal protein S15
dbj|BAF67454.1 Staphylococcus aureus subsp. aureus str. Newman     30S ribosomal protein S15
dbj|BAF78146.1 Staphylococcus aureus subsp. aureus Mu3     30Sribosomal protein S15
emb|CAG40251.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   30S ribosomal protein S15
emb|CAG42984.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   30S ribosomal protein S15
emb|CAI80824.1 Staphylococcus aureus RF122 EMBL   30S ribosomal protein S15
fig|158878.1.peg.1273 Staphylococcus aureus subsp. aureus Mu50 FIG   SSU ribosomal protein S15p (S13e)
fig|158878.14.peg.1307 Staphylococcus aureus subsp. aureus Mu50 FIG   SSU ribosomal protein S15p (S13e)
fig|158879.1.peg.1151 Staphylococcus aureus subsp. aureus N315 FIG   SSU ribosomal protein S15p (S13e)
fig|158879.11.peg.1195 Staphylococcus aureus subsp. aureus N315 FIG   SSU ribosomal protein S15p (S13e)
fig|196620.1.peg.1156 Staphylococcus aureus subsp. aureus MW2 FIG   SSU ribosomal protein S15p (S13e)
fig|196620.5.peg.1215 Staphylococcus aureus subsp. aureus MW2 FIG   SSU ribosomal protein S15p (S13e)
fig|273036.3.peg.1436 Staphylococcus aureus RF122 FIG   SSU ribosomal protein S15p (S13e)
fig|273036.6.peg.1207 Staphylococcus aureus RF122 FIG   SSU ribosomal protein S15p (S13e)
fig|282458.1.peg.1178 Staphylococcus aureus subsp. aureus MRSA252 FIG   SSU ribosomal protein S15p (S13e)
fig|282458.4.peg.1252 Staphylococcus aureus subsp. aureus MRSA252 FIG   SSU ribosomal protein S15p (S13e)
fig|282459.1.peg.1200 Staphylococcus aureus subsp. aureus MSSA476 FIG   SSU ribosomal protein S15p (S13e)
fig|282459.5.peg.1257 Staphylococcus aureus subsp. aureus MSSA476 FIG   SSU ribosomal protein S15p (S13e)
fig|359786.13.peg.1413 Staphylococcus aureus subsp. aureus JH9 FIG   SSU ribosomal protein S15p (S13e)
fig|359786.3.peg.2230 Staphylococcus aureus subsp. aureus JH9 FIG   SSU ribosomal protein S15p (S13e)
fig|359787.11.peg.1393 Staphylococcus aureus subsp. aureus JH1 FIG   SSU ribosomal protein S15p (S13e)
fig|359787.3.peg.1667 Staphylococcus aureus subsp. aureus JH1 FIG   SSU ribosomal protein S15p (S13e)
fig|367830.3.peg.669 Staphylococcus aureus subsp. aureus USA300 FIG   SSU ribosomal protein S15p (S13e)
fig|418127.4.peg.1169 Staphylococcus aureus subsp. aureus Mu3 FIG   SSU ribosomal protein S15p (S13e)
fig|418127.6.peg.1287 Staphylococcus aureus subsp. aureus Mu3 FIG   SSU ribosomal protein S15p (S13e)
fig|426430.6.peg.1148 Staphylococcus aureus subsp. aureus str. Newman FIG   SSU ribosomal protein S15p (S13e)
fig|426430.8.peg.1289 Staphylococcus aureus subsp. aureus str. Newman FIG   SSU ribosomal protein S15p (S13e)
fig|450394.6.peg.504 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   SSU ribosomal protein S15p (S13e)
fig|451515.3.peg.1278 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   SSU ribosomal protein S15p (S13e)
fig|451516.9.peg.1282 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   SSU ribosomal protein S15p (S13e)
fig|452948.4.peg.311 Staphylococcus aureus 930918-3 FIG   SSU ribosomal protein S15p (S13e)
fig|455227.3.peg.83 Staphylococcus aureus D30 FIG   SSU ribosomal protein S15p (S13e)
fig|505321.3.peg.1940 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   SSU ribosomal protein S15p (S13e)
fig|546342.3.peg.1145 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   SSU ribosomal protein S15p (S13e)
fig|546343.3.peg.2571 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   SSU ribosomal protein S15p (S13e)
fig|548470.3.peg.91 Staphylococcus aureus subsp. aureus MN8 FIG   SSU ribosomal protein S15p (S13e)
fig|548473.3.peg.2079 Staphylococcus aureus subsp. aureus TCH60 FIG   SSU ribosomal protein S15p (S13e)
fig|548474.3.peg.1038 Staphylococcus aureus subsp. aureus TCH130 FIG   SSU ribosomal protein S15p (S13e)
fig|548475.3.peg.188 Staphylococcus aureus subsp. aureus TCH70 FIG   SSU ribosomal protein S15p (S13e)
fig|553565.3.peg.1525 Staphylococcus aureus A5937 FIG   SSU ribosomal protein S15p (S13e)
fig|553567.3.peg.2079 Staphylococcus aureus A5948 FIG   SSU ribosomal protein S15p (S13e)
fig|553568.3.peg.1719 Staphylococcus aureus A6224 FIG   SSU ribosomal protein S15p (S13e)
fig|553571.3.peg.2606 Staphylococcus aureus A6300 FIG   SSU ribosomal protein S15p (S13e)
fig|553573.3.peg.2470 Staphylococcus aureus A8115 FIG   SSU ribosomal protein S15p (S13e)
fig|553574.3.peg.114 Staphylococcus aureus A8117 FIG   SSU ribosomal protein S15p (S13e)
fig|553577.3.peg.501 Staphylococcus aureus A8796 FIG   SSU ribosomal protein S15p (S13e)
fig|553580.3.peg.1356 Staphylococcus aureus A8819 FIG   SSU ribosomal protein S15p (S13e)
fig|553581.3.peg.925 Staphylococcus aureus A9299 FIG   SSU ribosomal protein S15p (S13e)
fig|553583.3.peg.1403 Staphylococcus aureus A9635 FIG   SSU ribosomal protein S15p (S13e)
fig|553588.3.peg.1991 Staphylococcus aureus A9719 FIG   SSU ribosomal protein S15p (S13e)
fig|553590.4.peg.325 Staphylococcus aureus A9754 FIG   SSU ribosomal protein S15p (S13e)
fig|553592.3.peg.2404 Staphylococcus aureus A9763 FIG   SSU ribosomal protein S15p (S13e)
fig|553594.3.peg.484 Staphylococcus aureus A9765 FIG   SSU ribosomal protein S15p (S13e)
fig|553596.3.peg.2605 Staphylococcus aureus A9781 FIG   SSU ribosomal protein S15p (S13e)
fig|553601.3.peg.1196 Staphylococcus aureus A10102 FIG   SSU ribosomal protein S15p (S13e)
fig|585143.3.peg.1807 Staphylococcus aureus subsp. aureus 55/2053 FIG   SSU ribosomal protein S15p (S13e)
fig|585144.3.peg.1193 Staphylococcus aureus subsp. aureus 58-424 FIG   SSU ribosomal protein S15p (S13e)
fig|585145.3.peg.2237 Staphylococcus aureus subsp. aureus 65-1322 FIG   SSU ribosomal protein S15p (S13e)
fig|585146.3.peg.1851 Staphylococcus aureus subsp. aureus 68-397 FIG   SSU ribosomal protein S15p (S13e)
fig|585147.3.peg.844 Staphylococcus aureus subsp. aureus A017934/97 FIG   SSU ribosomal protein S15p (S13e)
fig|585148.3.peg.762 Staphylococcus aureus subsp. aureus Btn1260 FIG   SSU ribosomal protein S15p (S13e)
fig|585149.6.peg.1363 Staphylococcus aureus subsp. aureus C101 FIG   SSU ribosomal protein S15p (S13e)
fig|585150.3.peg.2238 Staphylococcus aureus subsp. aureus C160 FIG   SSU ribosomal protein S15p (S13e)
fig|585151.3.peg.1187 Staphylococcus aureus subsp. aureus C427 FIG   SSU ribosomal protein S15p (S13e)
fig|585152.3.peg.1241 Staphylococcus aureus subsp. aureus D139 FIG   SSU ribosomal protein S15p (S13e)
fig|585153.3.peg.2351 Staphylococcus aureus subsp. aureus E1410 FIG   SSU ribosomal protein S15p (S13e)
fig|585154.3.peg.1503 Staphylococcus aureus subsp. aureus EMRSA16 FIG   SSU ribosomal protein S15p (S13e)
fig|585155.3.peg.1453 Staphylococcus aureus subsp. aureus H19 FIG   SSU ribosomal protein S15p (S13e)
fig|585156.3.peg.745 Staphylococcus aureus subsp. aureus M1015 FIG   SSU ribosomal protein S15p (S13e)
fig|585157.3.peg.995 Staphylococcus aureus subsp. aureus M809 FIG   SSU ribosomal protein S15p (S13e)
fig|585158.3.peg.1718 Staphylococcus aureus subsp. aureus M876 FIG   SSU ribosomal protein S15p (S13e)
fig|585159.3.peg.1324 Staphylococcus aureus subsp. aureus M899 FIG   SSU ribosomal protein S15p (S13e)
fig|585160.3.peg.740 Staphylococcus aureus subsp. aureus WBG10049 FIG   SSU ribosomal protein S15p (S13e)
fig|585161.3.peg.1132 Staphylococcus aureus subsp. aureus WW2703/97 FIG   SSU ribosomal protein S15p (S13e)
fig|585891.3.peg.1304 Staphylococcus aureus subsp. aureus Mu50-omega FIG   SSU ribosomal protein S15p (S13e)
fig|644279.4.peg.1352 Staphylococcus aureus subsp. aureus 132 FIG   SSU ribosomal protein S15p (S13e)
fig|680649.3.peg.150 Staphylococcus aureus subsp. aureus MR1 FIG   SSU ribosomal protein S15p (S13e)
fig|681288.4.peg.1250 Staphylococcus aureus subsp. aureus ED98 FIG   SSU ribosomal protein S15p (S13e)
fig|703339.3.peg.1249 Staphylococcus aureus 04-02981 FIG   SSU ribosomal protein S15p (S13e)
fig|762962.3.peg.782 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   SSU ribosomal protein S15p (S13e)
fig|93061.3.peg.1195 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   SSU ribosomal protein S15p (S13e)
fig|93062.19.peg.1262 Staphylococcus aureus subsp. aureus COL FIG   SSU ribosomal protein S15p (S13e)
fig|93062.4.peg.1262 Staphylococcus aureus subsp. aureus COL FIG   SSU ribosomal protein S15p (S13e)
gb|AAW38123.1 Staphylococcus aureus subsp. aureus COL     ribosomal protein S15
gb|ABD22079.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     30S ribosomal protein S15
gb|ABD30351.1 Staphylococcus aureus subsp. aureus NCTC 8325     ribosomal protein S15
gb|ABQ49130.1 Staphylococcus aureus subsp. aureus JH9     SSU ribosomal protein S15P
gb|ABR52210.1 Staphylococcus aureus subsp. aureus JH1     ribosomal protein S15
gb|ABX29219.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     ribosomal protein S15
gb|EEI94856.1 Staphylococcus aureus subsp. aureus MN8     30S ribosomal protein S15
gb|EEJ61161.1 Staphylococcus aureus subsp. aureus TCH60     30S ribosomal protein S15
gb|EES54836.1 Staphylococcus aureus subsp. aureus TCH70     30S ribosomal protein S15
gb|EES93031.1 Staphylococcus aureus subsp. aureus USA300_TCH959     30S ribosomal protein S15
gb|EES97272.1 Staphylococcus aureus subsp. aureus TCH130     30S ribosomal protein S15
gb|EEV03922.1 Staphylococcus aureus subsp. aureus 55/2053     30S ribosomal protein S15
gb|EEV06316.1 Staphylococcus aureus subsp. aureus 65-1322     SSU ribosomal protein S15
gb|EEV09368.1 Staphylococcus aureus subsp. aureus 68-397     ribosomal protein S15
gb|EEV11611.1 Staphylococcus aureus subsp. aureus E1410     30Sribosomal protein S15
gb|EEV14625.1 Staphylococcus aureus subsp. aureus M876     SSU ribosomal protein S15
gb|EEV27983.1 Staphylococcus aureus A9781     30S ribosomal protein S15
gb|EEV63698.1 Staphylococcus aureus A9763     30S ribosomal protein S15
gb|EEV66768.1 Staphylococcus aureus A9719     SSU ribosomal protein S15
gb|EEV69944.1 Staphylococcus aureus A9635     SSU ribosomal protein S15
gb|EEV73156.1 Staphylococcus aureus A9299     ribosomal protein S15
gb|EEV74057.1 Staphylococcus aureus A8115     30Sribosomal protein S15
gb|EEV76706.1 Staphylococcus aureus A6300     30S ribosomal protein S15
gb|EEV80284.1 Staphylococcus aureus A6224     ribosomal protein S15
gb|EEV82632.1 Staphylococcus aureus A5948     30S ribosomal protein S15
gb|EEV85924.1 Staphylococcus aureus A5937     ribosomal protein S15
gb|EEW45731.1 Staphylococcus aureus 930918-3     30S ribosomal protein S15
gb|EEW48283.1 Staphylococcus aureus D30     30S ribosomal protein S15
gi|118597467 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S15
gi|118597468 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S15
gi|118597469 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S15
gi|13701073 Staphylococcus aureus subsp. aureus N315 NCBI   30Sribosomal protein S15
gi|14247043 Staphylococcus aureus subsp. aureus Mu50 NCBI   30Sribosomal protein S15
gi|147740832 Staphylococcus aureus subsp. aureus JH9 NCBI   SSU ribosomal protein S15P
gi|148267763 Staphylococcus aureus subsp. aureus JH9 NCBI   30S ribosomal protein S15
gi|149946274 Staphylococcus aureus subsp. aureus JH1 NCBI   ribosomal protein S15
gi|150374194 Staphylococcus aureus subsp. aureus str. Newman NCBI   30S ribosomal protein S15
gi|150393822 Staphylococcus aureus subsp. aureus JH1 NCBI   30S ribosomal protein S15
gi|151221394 Staphylococcus aureus subsp. aureus str. Newman NCBI   30S ribosomal protein S15
gi|156721729 Staphylococcus aureus subsp. aureus Mu3 NCBI   30Sribosomal protein S15
gi|156979594 Staphylococcus aureus subsp. aureus Mu3 NCBI   30S ribosomal protein S15
gi|15924263 Staphylococcus aureus subsp. aureus Mu50 NCBI   30S ribosomal protein S15
gi|15926856 Staphylococcus aureus subsp. aureus N315 NCBI   30S ribosomal protein S15
gi|160368248 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   ribosomal protein S15
gi|161509439 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   30S ribosomal protein S15
gi|166234370 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S15
gi|172048868 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S15
gi|189044359 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S15
gi|189044360 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S15
gi|189044361 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S15
gi|21204324 Staphylococcus aureus subsp. aureus MW2 NCBI   30Sribosomal protein S15
gi|21282885 Staphylococcus aureus subsp. aureus MW2 NCBI   30S ribosomal protein S15
gi|221138143 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   30S ribosomal protein S15
gi|221142507 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   30S ribosomal protein S15
gi|227245097 Staphylococcus aureus subsp. aureus MN8 NCBI   30S ribosomal protein S15
gi|227558508 Staphylococcus aureus subsp. aureus MN8 NCBI   30S ribosomal protein S15
gi|227851363 Staphylococcus aureus subsp. aureus TCH60 NCBI   30S ribosomal protein S15
gi|227900300 Staphylococcus aureus subsp. aureus TCH60 NCBI   30S ribosomal protein S15
gi|251802179 Staphylococcus aureus subsp. aureus TCH70 NCBI   30S ribosomal protein S15
gi|251814184 Staphylococcus aureus subsp. aureus TCH70 NCBI   30S ribosomal protein S15
gi|253316409 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   30S ribosomal protein S15
gi|253724302 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   30S ribosomal protein S15
gi|253728543 Staphylococcus aureus subsp. aureus TCH130 NCBI   30S ribosomal protein S15
gi|253731892 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   30S ribosomal protein S15
gi|253733489 Staphylococcus aureus subsp. aureus TCH130 NCBI   30S ribosomal protein S15
gi|255006060 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   30S ribosomal protein S15
gi|257271784 Staphylococcus aureus subsp. aureus 55/2053 NCBI   30S ribosomal protein S15
gi|257274829 Staphylococcus aureus subsp. aureus 65-1322 NCBI   SSU ribosomal protein S15
gi|257278749 Staphylococcus aureus subsp. aureus 68-397 NCBI   ribosomal protein S15
gi|257281474 Staphylococcus aureus subsp. aureus E1410 NCBI   30Sribosomal protein S15
gi|257284505 Staphylococcus aureus subsp. aureus M876 NCBI   SSU ribosomal protein S15
gi|257425327 Staphylococcus aureus subsp. aureus 55/2053 NCBI   30S ribosomal protein S15
gi|257427988 Staphylococcus aureus subsp. aureus 65-1322 NCBI   SSU ribosomal protein S15
gi|257430621 Staphylococcus aureus subsp. aureus 68-397 NCBI   ribosomal protein S15
gi|257433381 Staphylococcus aureus subsp. aureus E1410 NCBI   30Sribosomal protein S15
gi|257436223 Staphylococcus aureus subsp. aureus M876 NCBI   SSU ribosomal protein S15
gi|257789643 Staphylococcus aureus A9781 NCBI   30S ribosomal protein S15
gi|257795671 Staphylococcus aureus A9781 NCBI   30S ribosomal protein S15
gi|257839222 Staphylococcus aureus A9763 NCBI   30S ribosomal protein S15
gi|257842343 Staphylococcus aureus A9719 NCBI   SSU ribosomal protein S15
gi|257845915 Staphylococcus aureus A9635 NCBI   SSU ribosomal protein S15
gi|257849174 Staphylococcus aureus A9299 NCBI   ribosomal protein S15
gi|257850104 Staphylococcus aureus A8115 NCBI   30Sribosomal protein S15
gi|257853747 Staphylococcus aureus A6300 NCBI   30S ribosomal protein S15
gi|257857386 Staphylococcus aureus A6224 NCBI   ribosomal protein S15
gi|257859790 Staphylococcus aureus A5948 NCBI   30S ribosomal protein S15
gi|257863160 Staphylococcus aureus A5937 NCBI   ribosomal protein S15
gi|258416074 Staphylococcus aureus A9763 NCBI   30S ribosomal protein S15
gi|258421657 Staphylococcus aureus A9719 NCBI   SSU ribosomal protein S15
gi|258423886 Staphylococcus aureus A9635 NCBI   SSU ribosomal protein S15
gi|258434813 Staphylococcus aureus A9299 NCBI   ribosomal protein S15
gi|258444611 Staphylococcus aureus A8115 NCBI   30Sribosomal protein S15
gi|258447556 Staphylococcus aureus A6300 NCBI   30S ribosomal protein S15
gi|258449398 Staphylococcus aureus A6224 NCBI   ribosomal protein S15
gi|258452572 Staphylococcus aureus A5948 NCBI   30S ribosomal protein S15
gi|258454777 Staphylococcus aureus A5937 NCBI   ribosomal protein S15
gi|259160710 Staphylococcus aureus 930918-3 NCBI   30S ribosomal protein S15
gi|259163728 Staphylococcus aureus D30 NCBI   30S ribosomal protein S15
gi|49241565 Staphylococcus aureus subsp. aureus MRSA252 NCBI   30S ribosomal protein S15
gi|49244555 Staphylococcus aureus subsp. aureus MSSA476 NCBI   30S ribosomal protein S15
gi|49483436 Staphylococcus aureus subsp. aureus MRSA252 NCBI   30S ribosomal protein S15
gi|49486112 Staphylococcus aureus subsp. aureus MSSA476 NCBI   30S ribosomal protein S15
gi|57286029 Staphylococcus aureus subsp. aureus COL NCBI   ribosomal protein S15
gi|57651843 Staphylococcus aureus subsp. aureus COL NCBI   30S ribosomal protein S15
gi|81694631 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S15
gi|81696337 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S15
gi|81696499 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S15
gi|81704472 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S15
gi|81705785 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S15
gi|81781694 organism not parsed/found in ncbi nr NCBI   RecName: Full=30S ribosomal protein S15
gi|82656405 Staphylococcus aureus RF122 NCBI   30S ribosomal protein S15
gi|82750874 Staphylococcus aureus RF122 NCBI   30S ribosomal protein S15
gi|87127565 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   30S ribosomal protein S15
gi|87161591 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   30S ribosomal protein S15
gi|87202541 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   ribosomal protein S15
gi|88194983 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   30S ribosomal protein S15
img|637092771 Staphylococcus aureus aureus N315 IMG   30Sribosomal protein S15
img|637099785 Staphylococcus aureus aureus Mu50 IMG   30Sribosomal protein S15
img|637152049 Staphylococcus aureus aureus COL IMG   ribosomal protein S15
img|637154685 Staphylococcus aureus aureus MRSA252 IMG   30S ribosomal protein S15
img|637157437 Staphylococcus aureus aureus MSSA476 IMG   30S ribosomal protein S15
img|637298920 Staphylococcus aureus aureus MW2 IMG   30Sribosomal protein S15
img|637816086 Staphylococcus aureus RF122 IMG   30S ribosomal protein S15
img|637887818 Staphylococcus aureus aureus USA300 IMG   30S ribosomal protein S15
img|637893877 Staphylococcus aureus aureus NCTC 8325 IMG   ribosomal protein S15
img|639109067 Staphylococcus aureus aureus JH1 IMG   Ribosomal protein S15, bacterial chloroplast and mitochondrial type
img|640565682 Staphylococcus aureus aureus JH9 IMG   ribosomal protein S15
img|640779444 Staphylococcus aureus aureus JH1 IMG   ribosomal protein S15
img|640795563 Staphylococcus aureus aureus Newman IMG   30S ribosomal protein S15
img|640904007 Staphylococcus aureus aureus Mu3 IMG   30Sribosomal protein S15
img|641309170 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   ribosomal protein S15
img|641771867 Staphylococcus aureus aureus USA300_TCH959 IMG   ribosomal protein S15
kegg|saa:SAUSA300_1166 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   30S ribosomal protein S15
kegg|sab:SAB1135 Staphylococcus aureus RF122 KEGG   30S ribosomal protein S15
kegg|sac:SACOL1292 Staphylococcus aureus subsp. aureus COL KEGG   30S ribosomal protein S15
kegg|sae:NWMN_1182 Staphylococcus aureus subsp. aureus Newman KEGG   30S ribosomal protein S15
kegg|sah:SaurJH1_1359 Staphylococcus aureus subsp. aureus JH1 KEGG   30S ribosomal protein S15
kegg|saj:SaurJH9_1333 Staphylococcus aureus subsp. aureus JH9 KEGG   30S ribosomal protein S15
kegg|sam:MW1156 Staphylococcus aureus subsp. aureus MW2 KEGG   30S ribosomal protein S15
kegg|sao:SAOUHSC_01250 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   30S ribosomal protein S15
kegg|sar:SAR1249   KEGG   30S ribosomal protein S15
kegg|sas:SAS1207   KEGG   30S ribosomal protein S15
kegg|sau:SA1116   KEGG   30S ribosomal protein S15
kegg|sav:SAV1273   KEGG   30S ribosomal protein S15
kegg|saw:SAHV_1263 Staphylococcus aureus subsp. aureus Mu3 KEGG   30S ribosomal protein S15
kegg|sax:USA300HOU_1205 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   30S ribosomal protein S15
ref|NP_371797.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   30S ribosomal protein S15
ref|NP_374389.1 Staphylococcus aureus subsp. aureus N315 RefSeq   30S ribosomal protein S15
ref|NP_645973.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   30S ribosomal protein S15
ref|YP_001246706.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   30S ribosomal protein S15
ref|YP_001316497.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   30S ribosomal protein S15
ref|YP_001332216.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   30S ribosomal protein S15
ref|YP_001441853.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   30S ribosomal protein S15
ref|YP_001575098.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   30S ribosomal protein S15
ref|YP_040660.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   30S ribosomal protein S15
ref|YP_043333.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   30S ribosomal protein S15
ref|YP_186149.1 Staphylococcus aureus subsp. aureus COL RefSeq   30S ribosomal protein S15
ref|YP_416615.1 Staphylococcus aureus RF122 RefSeq   30S ribosomal protein S15
ref|YP_493863.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   30S ribosomal protein S15
ref|YP_499783.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   30S ribosomal protein S15
ref|ZP_03562945.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   30S ribosomal protein S15
ref|ZP_03567000.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   30S ribosomal protein S15
ref|ZP_03988555.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   30S ribosomal protein S15
ref|ZP_04018105.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   30S ribosomal protein S15
ref|ZP_04828657.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   30S ribosomal protein S15
ref|ZP_04839622.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   30S ribosomal protein S15
ref|ZP_04866057.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   30S ribosomal protein S15
ref|ZP_04867654.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   30S ribosomal protein S15
ref|ZP_05144661.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   30S ribosomal protein S15
ref|ZP_05601752.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   30S ribosomal protein S15
ref|ZP_05604386.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   SSU ribosomal protein S15
ref|ZP_05607003.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   ribosomal protein S15
ref|ZP_05609739.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   30Sribosomal protein S15
ref|ZP_05612270.1 Staphylococcus aureus subsp. aureus M876 RefSeq   SSU ribosomal protein S15
ref|ZP_05644650.1 Staphylococcus aureus A9781 RefSeq   30S ribosomal protein S15
ref|ZP_05682342.1 Staphylococcus aureus A9763 RefSeq   30S ribosomal protein S15
ref|ZP_05684581.1 Staphylococcus aureus A9719 RefSeq   SSU ribosomal protein S15
ref|ZP_05686771.1 Staphylococcus aureus A9635 RefSeq   SSU ribosomal protein S15
ref|ZP_05688887.1 Staphylococcus aureus A9299 RefSeq   ribosomal protein S15
ref|ZP_05692940.1 Staphylococcus aureus A8115 RefSeq   30Sribosomal protein S15
ref|ZP_05695700.1 Staphylococcus aureus A6300 RefSeq   30S ribosomal protein S15
ref|ZP_05697501.1 Staphylococcus aureus A6224 RefSeq   ribosomal protein S15
ref|ZP_05700578.1 Staphylococcus aureus A5948 RefSeq   30S ribosomal protein S15
ref|ZP_05702741.1 Staphylococcus aureus A5937 RefSeq   ribosomal protein S15
sp|A5ISF7 Staphylococcus aureus (strain JH9) SwissProt   30S ribosomal protein S15
sp|A6QGH2 Staphylococcus aureus (strain Newman) SwissProt   30S ribosomal protein S15
sp|A6U192 Staphylococcus aureus (strain JH1) SwissProt   30S ribosomal protein S15
sp|A7X1Q7 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   30S ribosomal protein S15
sp|A8Z3V3 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   30S ribosomal protein S15
sp|Q2FHG5 Staphylococcus aureus (strain USA300) SwissProt   30S ribosomal protein S15
sp|Q2G2Q1 Staphylococcus aureus (strain NCTC 8325) SwissProt   30S ribosomal protein S15
sp|Q2YXP3 Staphylococcus aureus (strain bovine RF122 / ET3-1) SwissProt   30S ribosomal protein S15
sp|Q5HGF8 Staphylococcus aureus (strain COL) SwissProt   30S ribosomal protein S15
sp|Q6G9U0 Staphylococcus aureus (strain MSSA476) SwissProt   30S ribosomal protein S15
sp|Q6GHG2 Staphylococcus aureus (strain MRSA252) SwissProt   30S ribosomal protein S15
sp|Q7A116 Staphylococcus aureus (strain MW2) SwissProt   30S ribosomal protein S15
sp|Q7A5X8 Staphylococcus aureus (strain N315) SwissProt   30S ribosomal protein S15
sp|Q99UJ9 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   30S ribosomal protein S15
sp|RS15_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S15
sp|RS15_STAA2 organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S15
sp|RS15_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S15
sp|RS15_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S15
sp|RS15_STAA9 organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S15
sp|RS15_STAAB organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S15
sp|RS15_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S15
sp|RS15_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S15
sp|RS15_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S15
sp|RS15_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S15
sp|RS15_STAAR organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S15
sp|RS15_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S15
sp|RS15_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S15
sp|RS15_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=30S ribosomal protein S15
tr|C2GCM2 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   30S ribosomal protein S15
tr|C2K8W5 Staphylococcus aureus subsp. aureus MN8 TrEMBL   30S ribosomal protein S15
tr|C5N515 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   30S ribosomal protein S15
tr|C5Q0I5 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   30S ribosomal protein S15
tr|C5QIP1 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   30S ribosomal protein S15


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
26 fig|93061.5.peg.1140 Translation initiation factor 2
39 fig|93061.5.peg.1141 Ribosome-binding factor A
30 fig|93061.5.peg.1142 tRNA pseudouridine synthase B (EC 4.2.1.70)
10 fig|93061.5.peg.1143 FMN adenylyltransferase (EC 2.7.7.2) / Riboflavin kinase (EC 2.7.1.26)
48 fig|93061.5.peg.1145 Polyribonucleotide nucleotidyltransferase (EC 2.7.7.8)
4 fig|93061.5.peg.1146 Ribonuclease J2 (endoribonuclease in RNA processing)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search