The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.3.peg.954: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_007795 from base 958153 to 969150 (10998 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
949 959334 958153 1182 -         ff Staphopain B precursor (EC 3.4.22.-) cds.949, GeneID:3920388, LocusTag:SAOUHSC_00987, YP_499540.1, gi|88194744
950 960426 959416 1011 - 81     1: 3 ff
ilit(
11767947)
ilit(12127798)
ilit(14747701)
ilit(3306605)
ilit(96922)
isu
dlit(96922)
dlit(3306605)
Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA cds.950, GeneID:3920389, LocusTag:SAOUHSC_00988, YP_499541.1, gi|88194745
951 962108 960954 1155 - 527     1: 4 ff
isu
isu
N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-) cds.951, GeneID:3920390, LocusTag:SAOUHSC_00989, YP_499542.1, gi|88194746
952 963314 962304 1011 - 195       ff membrane protein, putative cds.952, GeneID:3920391, LocusTag:SAOUHSC_00991, YP_499543.1, gi|88194747
953 963467 963886 420 + 152       ff Putative ATL autolysin transcription regulator cds.953, GeneID:3920392, LocusTag:SAOUHSC_00992, YP_499544.1, gi|88194748
954 963913 964023 111 + 26         hypothetical protein cds.954, GeneID:3920393, LocusTag:SAOUHSC_00993, YP_499545.1, gi|88194749
955 967863 964093 3771 - 69     10: 2 9 7 11 8 6 12 13 5 1 ff
isu
isu
isu
dlit(
7816834)
Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96) cds.955, GeneID:3920394, LocusTag:SAOUHSC_00994, YP_499546.1, gi|88194750
956 968525 968091 435 - 227     1: 10 ff GNAT family acetyltransferase YjcF cds.956, GeneID:3920395, LocusTag:SAOUHSC_00995, YP_499547.1, gi|88194751
957 969150 968680 471 - 154       ff FIG01108206: hypothetical protein cds.957, GeneID:3920396, LocusTag:SAOUHSC_00996, YP_499548.1, gi|88194752

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.3.peg.954 hypothetical protein
MSLCTQQKLNHELQAKVAVIVKIDGKQSPLFLLVYV

MD5 = 4fa888502bb399e5bcc044559f4a9971


  DNA Sequence

>fig|93061.3.peg.954 hypothetical protein
gtgtcgttgtgcacacaacaaaaattgaatcatgaattacaagcaaaagtagcggtgatt
gttaaaattgatggtaaacaatcaccgctatttttgcttgtgtatgtataa


  DNA with Flanking Sequence

>fig|93061.3.peg.954 hypothetical protein
aattataaaaaaagcatataatattataaataatatgtagtggagtagaacaacatgtat
aaacaacttgaaaaacttattacactgactaacaatgacttaaacttagtgaatagaaga
tttggacaacgcacggatatcacatctgaacagctagaacttctccgtattttatttaat
tacgatcgcttatcacagtatgatttgacgatgaagattagcagggaacaatctatagtt
tcaaggtggattaagaaattagttttgaaagggtacatcacaagtcaacaatctagcgaa
gatttaagatgtaaagaattaattttgactgatcaagcacgtacattaatttcacaaata
aataatgcacgttgcgaattgattgaagcaagatgtcaatgtttatcggaagtcgaatta
gacaatttaaatcaattacttgataagttaaatcaacgacgcatatcgttgtaacacgac
aatagcaaacacataatttagtgtcgttgtgcacacaacaaaaattgaatcatgaattac
aagcaaaagtagcggtgattgttaaaattgatggtaaacaatcaccgctatttttgcttg
tgtatgtataaaaaagggatcaaaggtcatcccccatgattgatagtgggggatgacttt
tgatcctatgttcatgttgcttatttatattgtgggatgtcgaagtatttgccgacttcg
ccaattttatcatagtagcctttgatgattttagcattgatgttagcccaatctacatct
gtagcatattggtgtgttcctggatgtgcaggattccatctcattttgtaaagtgtattt
tgaccagcttttacatatgagttgccgatgaatttagcaccaccaacgattgcttttgat
actgtgtcccaaccagcttgtttagcatatttaataccttcacgtaaaggatcgttatca
tatgcagcaataccaaatacgttatggtatttcgtgtttgagttagttacaactttgttg
ttcactacatctgcacctttcgctaattgagaagtaccgttacctgtttctaatagggca
tgtgagataagataaacttcattaatgccat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA0984 Staphylococcus aureus N315     conserved hypothetical protein
cmr|NT02SA1041 Staphylococcus aureus Mu50     hypothetical protein
cmr|NT08SA1004 Staphylococcus aureus subsp. aureus MRSA252     conserved hypothetical protein
cmr|NT09SA0984 Staphylococcus aureus subsp. aureus MSSA476     conserved hypothetical protein
cmr|SACOL1061 Staphylococcus aureus subsp. aureus COL     hypothetical protein
fig|282459.5.peg.1023 Staphylococcus aureus subsp. aureus MSSA476 FIG   hypothetical protein
fig|418127.4.peg.961 Staphylococcus aureus subsp. aureus Mu3 FIG   hypothetical protein
fig|426430.6.peg.890 Staphylococcus aureus subsp. aureus str. Newman FIG   hypothetical protein
fig|548475.3.peg.1283 Staphylococcus aureus subsp. aureus TCH70 FIG   hypothetical protein
fig|553567.3.peg.1497 Staphylococcus aureus A5948 FIG   hypothetical protein
fig|553583.3.peg.1070 Staphylococcus aureus A9635 FIG   hypothetical protein
fig|585147.3.peg.534 Staphylococcus aureus subsp. aureus A017934/97 FIG   hypothetical protein
fig|585149.6.peg.1136 Staphylococcus aureus subsp. aureus C101 FIG   hypothetical protein
fig|585156.3.peg.518 Staphylococcus aureus subsp. aureus M1015 FIG   hypothetical protein
fig|680649.3.peg.2430 Staphylococcus aureus subsp. aureus MR1 FIG   hypothetical protein
gb|AAY21145.1 Staphylococcus aureus subsp. aureus COL     hypothetical protein SACOL1061
gb|ABD30117.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ48911.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_1111
gb|ABR51988.1 Staphylococcus aureus subsp. aureus JH1     conserved hypothetical protein
gb|EES93388.1 Staphylococcus aureus subsp. aureus USA300_TCH959     conserved hypothetical protein
gb|EEW47108.1 Staphylococcus aureus D30     hypothetical protein SAD30_2081
gi|147740613 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_1111
gi|148267544 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_1111
gi|149946052 Staphylococcus aureus subsp. aureus JH1 NCBI   conserved hypothetical protein
gi|150393600 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_1134
gi|253724659 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   conserved hypothetical protein
gi|253731660 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   conserved hypothetical protein
gi|259162539 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_2081
gi|62910585 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL1061
gi|87202307 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194749 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00993
img|637893638 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640565462 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640779221 Staphylococcus aureus aureus JH1 IMG   hypothetical protein
img|641772575 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|sah:SaurJH1_1134 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_1111 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sao:SAOUHSC_00993 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
ref|YP_001246487.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_1111
ref|YP_001316275.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_1134
ref|YP_499545.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00993
ref|ZP_04865825.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   conserved hypothetical protein
tr|A5IRT8 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein
tr|A6U0M0 Staphylococcus aureus (strain JH1) TrEMBL   Putative uncharacterized protein
tr|C5N4D3 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Putative uncharacterized protein
tr|Q2FZK8 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q52K45 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
isoelectric_point 9.34
molecular_weight 4056
PSORT::unknown unknown
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search