The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.3.peg.635: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_007795 from base 644285 to 656579 (12295 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
629 644285 645253 969 +       1: 2 ff
isu
Phosphoenolpyruvate-dihydroxyacetone phosphotransferase (EC 2.7.1.121), dihydroxyacetone binding subunit DhaK cds.629, GeneID:3919946, LocusTag:SAOUHSC_00655, YP_499214.1, gi|88194421
630 645295 645879 585 + 41     1: 2 ff
isu
Phosphoenolpyruvate-dihydroxyacetone phosphotransferase (EC 2.7.1.121), ADP-binding subunit DhaL cds.630, GeneID:3919947, LocusTag:SAOUHSC_00656, YP_499215.1, gi|88194422
631 645872 646234 363 + -8     1: 2 ff
isu
Phosphoenolpyruvate-dihydroxyacetone phosphotransferase (EC 2.7.1.121), subunit DhaM; DHA-specific IIA component cds.631, GeneID:3919948, LocusTag:SAOUHSC_00658, YP_499216.1, gi|88194423
632 646350 646847 498 + 115       ff FIG01107983: hypothetical protein cds.632, GeneID:3919949, LocusTag:SAOUHSC_00659, YP_499217.1, gi|88194424
633 647303 648370 1068 + 455       ff FIG01108275: hypothetical protein cds.633, GeneID:3919950, LocusTag:SAOUHSC_00660, YP_499218.1, gi|88194425
634 648521 649564 1044 + 150       ff Lipase LipA cds.634, GeneID:3919951, LocusTag:SAOUHSC_00661, YP_499219.1, gi|88194426
635 649917 649729 189 - 164         hypothetical protein cds.635, GeneID:3921680, LocusTag:SAOUHSC_A00635, YP_499220.1, gi|88196678
636 649893 650321 429 + -25       ff FIG01108082: hypothetical protein cds.636, GeneID:3919952, LocusTag:SAOUHSC_00662, YP_499221.1, gi|88194427
637 651036 650530 507 - 208       ff Acetyltransferase GNAT family cds.637, GeneID:3919953, LocusTag:SAOUHSC_00663, YP_499222.1, gi|88194428
638 651149 652072 924 + 112       ff FIG01107875: hypothetical protein cds.638, GeneID:3919954, LocusTag:SAOUHSC_00664, YP_499223.1, gi|88194429
639 652088 652762 675 + 15     1: 1 ff
ilit(
14612242)
isu
Two-component response regulator BceR cds.639, GeneID:3919955, LocusTag:SAOUHSC_00665, YP_499224.1, gi|88194430
640 652755 653795 1041 + -8     1: 1 ff
ilit(
14612242)
isu
Two-component sensor histidine kinase BceS cds.640, GeneID:3919429, LocusTag:SAOUHSC_00666, YP_499225.1, gi|88194431
641 653939 654700 762 + 143     1: 1 ff
ilit(
14612242)
isu
Bacitracin export ATP-binding protein BceA cds.641, GeneID:3919430, LocusTag:SAOUHSC_00667, YP_499226.1, gi|88194432
642 654690 656579 1890 + -11     1: 1 ff
idu(2)
ilit(
14612242)
Bacitracin export permease protein BceB cds.642, GeneID:3919431, LocusTag:SAOUHSC_00668, YP_499227.1, gi|88194433

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.3.peg.635 hypothetical protein
MVLMLTLSFPFTTLFQITSCSIYILIFLLNSFQFINLLYHVHTVFRQFSCKKLFSGSKQI
SL

MD5 = 32f3abf30074f985b5c489bd164e3d94


  DNA Sequence

>fig|93061.3.peg.635 hypothetical protein
atggttttaatgctgaccttgtcattccctttcacaaccttatttcaaatcacttcgtgc
tcaatctatattttaatttttcttttgaattcttttcaatttataaatttattatatcat
gtacacactgtttttcgacaatttagttgtaaaaagttattttcaggttcaaaacaaatt
agtttgtaa


  DNA with Flanking Sequence

>fig|93061.3.peg.635 hypothetical protein
cttattcatttatcaaatttaaattcaaaataaaacaccactaatgtgtaattgattaac
tatcaactacgattagtggtgctttatatatgttgtttagttttccttactataaaaatc
ttcgagtctaaaatctatatccggtaatttttcatatatcttatcctgatactgattgtt
ttgattgtaagcttcttcagtaattaacctacctttacgcttaattccataatcttgtac
gaataaattattatttctatttattttgtaatacggtacaacattcgcactaaattttac
tcgttgatgaataagttccattgccaatgcatagtatttatttgtctcatataaccataa
atgatctattgatacacctgaaacaaatacatcttttaataatatccttacattcggctt
aaatgtgctatgtctatctaaataatttttaaacaaaacacgttgtatacgtccagtaac
cataacgcgtttatttttaaatggttttaatgctgaccttgtcattccctttcacaacct
tatttcaaatcacttcgtgctcaatctatattttaatttttcttttgaattcttttcaat
ttataaatttattatatcatgtacacactgtttttcgacaatttagttgtaaaaagttat
tttcaggttcaaaacaaattagtttgtaaaataaatgtcacatcataatagagtgagata
gaaatgataaagaaccgctaacaatttattatatctcagactcttacacattagcaccac
atgttttaaattcttcgtttttaatttgaaaatcttaaatgttgcttaagtaataaatta
ctactgtttatcattagtttaaaggatttaacggtaattcattactcggattttctattt
gtggtttctcttcagtttgaataccactagaggatgtattacgacttaagaaaagtaaca
cttttttgatattatctatcgattcaggtttattaaggtgaaattgatactgatgatgta
aatgatgcgtaccatcataaaacaaagtatctactggtacattcaattcttgtaatttct
tactgaattctatattttgactttcgaatggatcgctatctccaacagataaaaatgttg
gtggataattttttgtcgattgttttactgtcgacatttgtgaaatgtt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
gb|ABD32046.1 Staphylococcus aureus subsp. aureus NCTC 8325     hypothetical protein SAOUHSC_A00635
gb|EEW48104.1 Staphylococcus aureus D30     hypothetical protein SAD30_2186
gi|259163547 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_2186
gi|87204236 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_A00635
gi|88196678 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_A00635
img|637893310 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
kegg|sao:SAOUHSC_A00635 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
ref|YP_499220.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_A00635
tr|Q2G0E4 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
isoelectric_point 9.91
molecular_weight 7271
Phobius::transmembrane 14-39
PSORT::unknown unknown
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search