The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.3.peg.587: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Doubtful CDS. No database matches
Translate Function Assignments



Context on contig NC_007795 from base 595555 to 607015 (11461 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
581 595555 596493 939 +       1: 1 ff
isu
Oxidoreductase ion channel cds.581, GeneID:3918922, LocusTag:SAOUHSC_00603, YP_499166.1, gi|88194373
582 596704 597240 537 + 210     1: 1 ff
isu
hypothetical fig|282458.1.peg.578 homolog cds.582, GeneID:3918923, LocusTag:SAOUHSC_00604, YP_499167.1, gi|88194374
583 597409 597885 477 + 168     1: 1 ff
isu
hypothetical fig|282458.1.peg.579 homolog cds.583, GeneID:3918924, LocusTag:SAOUHSC_00605, YP_499168.1, gi|88194375
584 597925 599220 1296 + 39     3: 1 14 4 ff
ilit(
15496593)
ilit(1645840)
ilit(19438719)
ilit(2157212)
ilit(2165018)
isu
isu
dNTP triphosphohydrolase, putative cds.584, GeneID:3918925, LocusTag:SAOUHSC_00606, YP_499169.1, gi|88194376
585 599248 599769 522 + 27     1: 1 ff
isu
hypothetical fig|282458.1.peg.581 homolog cds.585, GeneID:3918926, LocusTag:SAOUHSC_00607, YP_499170.1, gi|88194377
586 600268 601278 1011 + 498     11: 1 12 9 18 19 17 21 6 15 16 20 ff
idu(3)
idu(3)
idu(3)
idu(3)
ilit(
2185223)
ilit(2308827)
isu
Alcohol dehydrogenase (EC 1.1.1.1) cds.586, GeneID:3918927, LocusTag:SAOUHSC_00608, YP_499171.1, gi|88194378
587 601353 601460 108 + 74       ff Doubtful CDS. No database matches cds.587, GeneID:3918928, LocusTag:SAOUHSC_00609, YP_499172.1, gi|88194379
588 601586 601969 384 + 125       ff hypothetical fig|282458.1.peg.583 homolog cds.588, GeneID:3918929, LocusTag:SAOUHSC_00610, YP_499173.1, gi|88194380
589 601966 603627 1662 + -4     2: 7 13 ff
ilit(
16430231)
ilit(2668891)
ilit(7590355)
ilit(8497194)
ilit(9736621)
isu
Arginyl-tRNA synthetase (EC 6.1.1.19) cds.589, GeneID:3918930, LocusTag:SAOUHSC_00611, YP_499174.1, gi|88194381
590 604016 604651 636 + 388     2: 3 5 ff Endonuclease III (EC 4.2.99.18) cds.590, GeneID:3918931, LocusTag:SAOUHSC_00612, YP_499175.1, gi|88194382
591 605090 605917 828 + 438     3: 2 8 10 ff
ilit(
11790740)
ilit(12468528)
Vitamin B12 ABC transporter, B12-binding component BtuF cds.591, GeneID:3918932, LocusTag:SAOUHSC_00613, YP_499176.1, gi|88194383
592 606065 607015 951 + 147     2: 2 11 ff
isu
Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1) cds.592, GeneID:3918933, LocusTag:SAOUHSC_00614, YP_499177.1, gi|88194384

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.3.peg.587 Doubtful CDS. No database matches
MKDSENLVFFGFEVLFVFYKMAYIYEALIKYGIVN

MD5 = 9a8a9bde39b718d602c01f4e6ee26d43


  DNA Sequence

>fig|93061.3.peg.587 Doubtful CDS. No database matches
atgaaagatagtgaaaatctcgtgttttttggttttgaggtgttgtttgtattttataaa
atggcttacatatatgaagcgttgattaagtatggaattgttaattaa


  DNA with Flanking Sequence

>fig|93061.3.peg.587 Doubtful CDS. No database matches
gatgataaattagcattcgcgaaagaattaggtgctgatgctattattaattctaaagat
gttgatccagttgcagaagttatgaaattaactgataacaaaggattagatgcaacagtg
gtaacttcagttgctaagacgccatttaaccaagcggttgatgttgtaaaagctggtgca
agagttgttgccgttggtttacctgttgataaaatgaacttagatatcccaagattagtg
cttgatggtattgaagtagtaggttcacttgttggtacaagacaagacttacgtgaagcg
tttgaatttgctgctgaaaataaagtaacacctaaagttcaattaagaaaattagaagaa
atcaatgatatttttgaagaaatggaaaatggtactataactggtagaatggttattaaa
ttttaaaaatatcaactgactatatagataaagaaggtagtgctctgaacactatcatta
taatcaaacacgaggttttcatgaaagatagtgaaaatctcgtgttttttggttttgagg
tgttgtttgtattttataaaatggcttacatatatgaagcgttgattaagtatggaattg
ttaattaattgaacctatttagctttaagaaggcataacaagatgaccttattttatgct
ataatatttctattatgcgaagattaaggtgagtagtaaattggataaaaaagtaagtat
tcaaacaaagcaagtgttgaaacagcacaacgaaaaagaaaaatttgaatttactactga
aggaacttggcaacaaaggcaatctaactttattcggtatgtagaacaaattgaggatgc
aacagttaatgttacaataaaagtggatgatgatagcgttaagttgattcgtaaaggcga
cattaatatgaatttgcattttgttgaaggacaaacgacaacaactttttacgatatatc
ggctggacgaattccactagaagttaaaacattacgcattttacatttcgtaagtggaga
cggtggcaagctaaagattcattatgaattatatcaagataatgaaaaaatgggttctta
tcaatatgaaattaactataaggagata


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT03SA0631 Staphylococcus aureus MW2     conserved hypothetical protein
cmr|SACOL0661 Staphylococcus aureus subsp. aureus COL     hypothetical protein
dbj|BAB94434.1 Staphylococcus aureus subsp. aureus MW2     hypothetical protein
emb|CAG42348.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   hypothetical protein
fig|196620.1.peg.569 Staphylococcus aureus subsp. aureus MW2 FIG   Doubtful CDS. No database matches
fig|282459.1.peg.567 Staphylococcus aureus subsp. aureus MSSA476 FIG   Doubtful CDS. No database matches
fig|282459.5.peg.598 Staphylococcus aureus subsp. aureus MSSA476 FIG   Doubtful CDS. No database matches
fig|548475.3.peg.905 Staphylococcus aureus subsp. aureus TCH70 FIG   Doubtful CDS. No database matches
fig|553567.3.peg.422 Staphylococcus aureus A5948 FIG   Doubtful CDS. No database matches
fig|93062.4.peg.153 Staphylococcus aureus subsp. aureus COL FIG   Doubtful CDS. No database matches
gb|AAW36351.1 Staphylococcus aureus subsp. aureus COL     hypothetical protein SACOL0661
gb|ABD29747.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX28636.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_0611
gb|EES55596.1 Staphylococcus aureus subsp. aureus TCH70     conserved hypothetical protein
gb|EEW45229.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1281
gb|EEW46821.1 Staphylococcus aureus D30     hypothetical protein SAD30_1164
gi|160367665 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0611
gi|161508856 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0611
gi|21203735 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein
gi|21282298 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW0569
gi|251802939 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|251813571 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|259160199 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1281
gi|259162246 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1164
gi|49243922 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein
gi|49485479 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS0573a
gi|57284257 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0661
gi|57650071 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0661
gi|87201937 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194379 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00609
img|637151441 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637156800 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637298329 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637893262 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|641308582 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
kegg|sac:SACOL0661 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sam:MW0569 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_00609 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS0573a   KEGG   hypothetical protein
kegg|sax:USA300HOU_0611 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_645386.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW0569
ref|YP_001574515.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_0611
ref|YP_042700.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS0573a
ref|YP_185545.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0661
ref|YP_499172.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00609
ref|ZP_04828044.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   conserved hypothetical protein
tr|A8Z115 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|C5QGX8 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Putative uncharacterized protein
tr|Q2G0G0 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HI62 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6GBM3 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative uncharacterized protein
tr|Q8NXU0 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW0569


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code ff
isoelectric_point 4.59
molecular_weight 4203
Phobius::transmembrane 7-25
PSORT::Extracellular 8.82
PSORT_score::Extracellular 8.82
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search