The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.3.peg.2263: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_007795 from base 2209007 to 2219284 (10278 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2257 2209007 2209327 321 +         ff Zn(II) or Co(II)-specific transcriptional repressor protein cds.2257, GeneID:3919605, LocusTag:SAOUHSC_02388, YP_500865.1, gi|88196051
2258 2209329 2210309 981 + 1     1: 10 ff
isu
Zn(II) and Co(II) transmembrane diffusion facilitator cds.2258, GeneID:3919606, LocusTag:SAOUHSC_02389, YP_500866.1, gi|88196052
2259 2210575 2211666 1092 + 265       ff Lytic regulatory protein cds.2259, GeneID:3919607, LocusTag:SAOUHSC_02390, YP_500867.1, gi|88196053
2260 2212213 2212109 105 - 442         hypothetical protein cds.2260, GeneID:3919608, LocusTag:SAOUHSC_02391, YP_500868.1, gi|88196054
2261 2212841 2212638 204 - 424         Resolvase/integrase cds.2261, GeneID:3919609, LocusTag:SAOUHSC_02392, YP_500869.1, gi|88196055
2262 2214036 2212900 1137 - 58         SAP domain protein cds.2262, GeneID:3919610, LocusTag:SAOUHSC_02393, YP_500870.1, gi|88196056
2263 2214325 2214417 93 + 288         hypothetical protein cds.2263, GeneID:3919611, LocusTag:SAOUHSC_02394, YP_500871.1, gi|88196057
2264 2214493 2214651 159 + 75         hypothetical protein cds.2264, GeneID:3921701, LocusTag:SAOUHSC_A02273, YP_500872.1, gi|88196699
2265 2215979 2215122 858 - 470       ff Hydrolase (HAD superfamily) cds.2265, GeneID:3919612, LocusTag:SAOUHSC_02396, YP_500873.1, gi|88196058
2266 2216829 2216047 783 - 67     3: 6 2 1 ff ABC transporter ATP-binding protein cds.2266, GeneID:3919613, LocusTag:SAOUHSC_02397, YP_500874.1, gi|88196059
2267 2218866 2217061 1806 - 231     9: 2 1 3 8 9 5 11 7 4 ff
ilit(
10898949)
ilit(11679416)
ilit(18263721)
ilit(2656689)
ilit(7476196)
ilit(8109175)
ilit(8144040)
ilit(8376346)
ilit(9612946)
isu
isu
isu
isu
Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16) cds.2267, GeneID:3919614, LocusTag:SAOUHSC_02399, YP_500875.1, gi|88196060
rna.108 2219284 2219068 217 - 201           glmS glucosamine-6-phosphate activated ribozyme

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.3.peg.2263 hypothetical protein
MFIFKTTSKSHFHNNVKSLECIKIPINKNR

MD5 = 94e331f7c1add196a3023d3c45592e7c


  DNA Sequence

>fig|93061.3.peg.2263 hypothetical protein
gtgtttatttttaaaacaacatctaaaagccattttcataataatgttaaatcattagaa
tgtataaagattccaattaataaaaatagataa


  DNA with Flanking Sequence

>fig|93061.3.peg.2263 hypothetical protein
aaaatactttgtaattcaggtcttgtctttttatatatactaacttcaaaatcattagtc
gttgttaataactcagcttcaattaatttttttattgaattcataatttgaacatcatta
ttagcaaggcacttattagcaaatatctcttctccaaccaatctatttacattagtgtgt
aatactaataaatcacgtgcatttacgctcactagctttcatctcctcatttttgctttt
caaatttattaagtatgaataaaaaatacatccgaacaaacaaaatctctatattctaat
tcgatttacatagattatacactaaaaaaatgattctcaatgcaaatgaatgtgtctctc
atagtctaaaaactcgtatgtttcgaattttatgattcattgataatagtaccagttaaa
agaactaagattgtaattatccccccttaaaattcaagaatatattttcttaatctatca
gcaagaggttatatttcaaagtgtttatttttaaaacaacatctaaaagccattttcata
ataatgttaaatcattagaatgtataaagattccaattaataaaaatagataaaatgcaa
taaagttccaaatacttattattattcatcacaaattacgtgatgccctctacaacacta
aatcaaggatgatatttattttatatacattagcattcattgtttgcttacccacattat
cctgtttagtcttttttataactctagtcttgaatgtcatatttacaaagaaaaaaacac
taaaatatttaaaactaacactatttattcactttgttcttttatagcaccttttatgtt
tattttcttgtattcaataaatagtatggagatgataatttaaagtagatatatttgaag
tatactatagagtaaattatattggggaaatatgtaaacgaaccggttgattttatagtg
gattaacacttcatagagaatataatcaagaacaaaaacagtcaataggtgtgaattttt
ttaaagacggatctgttgctactaaaaaaagaagtatacaattcaatagttaaaccttaa
aacaagaaatatt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
gb|ABD31425.1 Staphylococcus aureus subsp. aureus NCTC 8325     hypothetical protein SAOUHSC_02394
gb|ABX30137.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_2141
gb|EEW44575.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1796
gb|EEW46417.1 Staphylococcus aureus D30     hypothetical protein SAD30_0905
gi|160369166 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_2141
gi|161510357 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_2141
gi|259159526 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1796
gi|259161831 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0905
gi|87203615 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02394
gi|88196057 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02394
img|637895010 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|641310142 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
kegg|sao:SAOUHSC_02394 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_2141 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001576016.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_2141
ref|YP_500871.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02394
tr|A8YYB7 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|Q2FWA4 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
isoelectric_point 10.97
molecular_weight 3576
PSORT::Extracellular 8.82
PSORT_score::Extracellular 8.82
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search