The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.3.peg.2164: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_007795 from base 2116716 to 2127954 (11239 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2159 2116716 2118245 1530 +       3: 2 1 3 ff
ilit(
12070767)
ilit(12432038)
ilit(17189332)
ilit(2181403)
ilit(2420798)
ilit(3275644)
ilit(8117072)
ilit(8701612)
ilit(9139910)
isu
isu
2-isopropylmalate synthase (EC 2.3.3.13) cds.2159, GeneID:3919160, LocusTag:SAOUHSC_02285, YP_500767.1, gi|88195955
2160 2118248 2119294 1047 + 2     3: 2 1 3 ff
ilit(
10810156)
ilit(10940051)
ilit(15299625)
ilit(15663922)
ilit(1730062)
ilit(17449626)
ilit(1748999)
ilit(3110742)
ilit(4889950)
ilit(6321488)
ilit(6330094)
ilit(6396161)
ilit(7590327)
ilit(7881901)
ilit(8119295)
ilit(8294021)
ilit(8336106)
ilit(8405446)
ilit(8569539)
ilit(8875643)
ilit(9086278)
ilit(9108278)
ilit(9111927)
ilit(9720199)
ilit(9873079)
isu
isu
3-isopropylmalate dehydrogenase (EC 1.1.1.85) cds.2160, GeneID:3919161, LocusTag:SAOUHSC_02286, YP_500768.1, gi|88195956
2161 2119308 2120678 1371 + 13     6: 2 6 9 5 1 3 ff
ilit(
12070767)
ilit(1400210)
ilit(17449626)
ilit(2190189)
ilit(9813279)
isu
isu
3-isopropylmalate dehydratase large subunit (EC 4.2.1.33) cds.2161, GeneID:3919162, LocusTag:SAOUHSC_02287, YP_500769.1, gi|88195957
pbs.13 2120889 2120874 16 - 195         NrdR_Proteobacteria  
2162 2120679 2121251 573 + -211     4: 2 5 1 3 ff
ilit(
1400210)
ilit(17449626)
ilit(20170198)
ilit(8331070)
ilit(9813279)
isu
isu
3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) cds.2162, GeneID:3919163, LocusTag:SAOUHSC_02288, YP_500770.1, gi|88195958
2163 2121266 2122534 1269 + 14     9: 13 7 14 12 11 8 1 10 15 ff
ilit(
3290055)
isu
Threonine dehydratase biosynthetic (EC 4.3.1.19) cds.2163, GeneID:3919164, LocusTag:SAOUHSC_02289, YP_500771.1, gi|88195959
2164 2122738 2122583 156 - 48         hypothetical protein cds.2164, GeneID:3919165, LocusTag:SAOUHSC_02290, YP_500772.1, gi|88195960
rna.72 2122857 2122743 115 - 4     1: 4   5S rRNA rna.72
rna.73 2125852 2122930 2923 - 72     1: 4   LSU rRNA rna.73
rna.74 2127954 2126399 1556 - 546     2: 4 16   SSU rRNA SSU rRNA

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.3.peg.2164 hypothetical protein
MDAMSRIETARSLFLCLKRQNKSKHKERWLGEVKTFESDETRNVKYNKKQS

MD5 = 45969367968ef09f7cec056df4e19595


  DNA Sequence

>fig|93061.3.peg.2164 hypothetical protein
gtggatgcgatgagccgcattgagaccgcaaggtctctttttttatgtctaaaacgtcaa
aataaaagcaaacacaaagaaagatggcttggcgaagtgaaaacgtttgaatctgacgaa
acgagaaatgtaaagtataataaaaagcagtcataa


  DNA with Flanking Sequence

>fig|93061.3.peg.2164 hypothetical protein
aacgtcgtgagacagttcggtccctatccgtcgtgggcgtaggaaatttgagaggagctg
tccttagtacgagaggaccgggatggacatacctctggtgtaccagttgtcgtgccaacg
gcatagctgggtagctatgtgtggacgggataagtgctgaaagcatctaagcatgaagcc
cccctcaagatgagatttcccaacttcggttataagatccctcaaagatgatgaggttaa
taggttcgaggtggaagcatggtgacatgtggagctgacgaatactaatcgatcgaagac
ttaatcaaaataaatgttttgcgaagcaaaatcacttttacttactatctagttttgaat
gtataatttacattcatatgtctggtgactatagcaaggaggtcacacctgttcccatgc
cgaacacagaagttaagctccttagcgtcgatggtagtcgaacttacgttccgctagagt
agaacgttgccaggcaaaaagtggatgcgatgagccgcattgagaccgcaaggtctcttt
ttttatgtctaaaacgtcaaaataaaagcaaacacaaagaaagatggcttggcgaagtga
aaacgtttgaatctgacgaaacgagaaatgtaaagtataataaaaagcagtcataagatg
atttcaattagaaatcaatttatgactgtttttcttactatgtgttaaattaacaatgaa
tataacatcttattttcattaatataaatattggaaggatcgaaatgatttacacgttgt
ttgagttgtattaaatcatcatgatctttaagttgaataccaataatgacagtacctgta
ttttgagaagatttttttaagtattcaaatttagtaatatcgtcttgaggtcctaatacg
tcatttacaaattctctcaatgcacctggacgttgagggaaatttaagataaagtaatgc
ttcatttcttcgtatagtaatgaacgttcttcaatttctttcattcgattaatatcatta
ttaccaccactaatgacacaaaccactgttttacctttaatatgatctttatagttttca
agcgcacttacacttaatgcgccagcaggttctgctacaattgcttgttttgaatacata
tctaaaatcgtagaac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|SACOL2051 Staphylococcus aureus subsp. aureus COL     hypothetical protein
gb|AAY21108.1 Staphylococcus aureus subsp. aureus COL     hypothetical protein SACOL2051
gb|ABD31328.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gi|62910546 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL2051
gi|87203518 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88195960 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02290
img|637894906 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
kegg|sao:SAOUHSC_02290 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
ref|YP_500772.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02290
tr|Q2FWJ8 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q52K71 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
isoelectric_point 10.62
molecular_weight 6147
PSORT::unknown unknown
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search