The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.3.peg.1891: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_007795 from base 1907224 to 1917163 (9940 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1886 1907670 1907224 447 -       3: 5 18 16 ff
ilit(
9701813)
isu
isu
Peroxide stress regulator PerR, FUR family cds.1886, GeneID:3921877, LocusTag:SAOUHSC_01997, YP_500494.1, gi|88195685
opr.21 1907705 1907691 15 - 20         perR box of perR RTB_5246574
opr.29 1907748 1907677 72 - -29         perR promoter region RTB_5246656
1887 1908717 1907767 951 - 18       ff Phosphoglycerate dehydrogenase and related dehydrogenases cds.1887, GeneID:3921878, LocusTag:SAOUHSC_01998, YP_500495.1, gi|88195686
1888 1909178 1908723 456 - 5     6: 10 5 21 12 6 14 ff
ilit(
10644761)
isu
Thiol peroxidase, Bcp-type (EC 1.11.1.24) cds.1888, GeneID:3921879, LocusTag:SAOUHSC_01999, YP_500496.1, gi|88195687
opr.25 1909211 1909197 15 - 18         perR box of bcp RTB_5246628
1889 1909373 1910548 1176 + 161     6: 11 15 9 1 2 17 ff
idu(2)
ilit(
1643048)
ilit(1672867)
ilit(1900346)
ilit(2045363)
ilit(2254275)
ilit(7565600)
ilit(7908550)
ilit(8973563)
ilit(9202460)
ilit(9330910)
Glutamate-1-semialdehyde 2,1-aminomutase (EC 5.4.3.8) cds.1889, GeneID:3921880, LocusTag:SAOUHSC_02000, YP_500497.1, gi|88195688
1890 1910892 1911935 1044 + 343     2: 1 2 ff Putative lipoprotein SAV1865 cds.1890, GeneID:3921881, LocusTag:SAOUHSC_02001, YP_500498.1, gi|88195689
1891 1912117 1912025 93 - 89         hypothetical protein cds.1891, GeneID:3921882, LocusTag:SAOUHSC_02002, YP_500499.1, gi|88195690
1892 1913862 1912126 1737 - 8       ff
ilit(
16943773)
dlit(16943773)
Efflux ABC transporter, permease/ATP-binding protein YgaD cds.1892, GeneID:3921883, LocusTag:SAOUHSC_02003, YP_500500.1, gi|88195691
1893 1914695 1914153 543 - 290     1: 4 ff
isu
dlit(
27422825)
DUF402 family nucleoside diphosphatase cds.1893, GeneID:3921884, LocusTag:SAOUHSC_02004, YP_500501.1, gi|88195692
1894 1916034 1914997 1038 - 301     7: 8 20 7 13 19 4 3 ff
isu
isu
isu
A/G-specific adenine glycosylase (EC 3.2.2.-) cds.1894, GeneID:3921885, LocusTag:SAOUHSC_02005, YP_500502.1, gi|88195693
1895 1916186 1917163 978 + 151     3: 1 2 3 ff
isu
Uncharacterized membrane protein YfhP cds.1895, GeneID:3921886, LocusTag:SAOUHSC_02006, YP_500503.1, gi|88195694

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.3.peg.1891 hypothetical protein
MFDFSTILKRKFVTGWWGHNIEKAVRDFLN

MD5 = 39b6490ce4ad8e5cceffe6d219d6d53d


  DNA Sequence

>fig|93061.3.peg.1891 hypothetical protein
ttgtttgacttcagtacaatcttgaagagaaaatttgtaacaggatggtggggtcataac
atagaaaaagcagtaagagattttcttaattga


  DNA with Flanking Sequence

>fig|93061.3.peg.1891 hypothetical protein
caaataggattggtgcaacaggataatattttattctctgatacagttaaggaaaatatt
ttacttggtcgtccaacagcaacagatgaagaagtagttgaagcggcgaaaatggctaat
gcacatgactttattatgaacttgccacagggatatgacactgaagtaggtgaacgaggt
gttaaattatcaggtggtcaaaaacaaagattatcgattgctagaatatttttaaataat
ccgccaattcttatcttggatgaagcaacaagtgcacttgatttagaaagtgaatccatt
attcaagaagcattagatgtgttgagtaaagatcgaacgacacttatcgtagcgcatcgc
ttgtccactattacacatgctgacaaaattgtcgtaattgaaaatggacatattgttgaa
acaggtacgcatcgtgaattgattgcaaaacaaggtgcttacgagcatttatatagcatt
caaaacttataaagtattagttgtttgacttcagtacaatcttgaagagaaaatttgtaa
caggatggtggggtcataacatagaaaaagcagtaagagattttcttaattgaaaataat
cttactgcttttttaaatttaatttcgagattcaatattagtttatctcattgtggcatt
aattgataaaattgttttaatgttataaatcaaagtcttcttcaacaatttcaatgtctg
catcagatctatgatatgtgaaaaagctaattcttatgcggtctaaatgctctaaatggt
gtcgatactcttcgatggctgcaacaatttgcataacattggcaaacgaatattccgttt
gataaggatgatttattaactcatgctgaaatgtggacaataaatcttttttctgcggat
tatctaactcataatcaacatgtgtcacattataacgtgcttttttagaaaggctagcta
aaatttgctcgtgaaaagcagttaatgaatctaaatctaatttgatttgtaataggaaat
tgttattaagtaaatataagtcgttttgataacgcgacaatttgtttaatacttcataag
cttgtctagtcgt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
gb|ABD31058.1 Staphylococcus aureus subsp. aureus NCTC 8325     hypothetical protein SAOUHSC_02002
gi|87203248 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02002
gi|88195690 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02002
img|637894633 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|641771299 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|sao:SAOUHSC_02002 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
ref|YP_500499.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02002
tr|Q2G2N0 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
isoelectric_point 10.50
molecular_weight 3657
PSORT::Extracellular 8.82
PSORT_score::Extracellular 8.82
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search