The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.3.peg.144: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: Inner membrane protein YbaN
Translate Function Assignments



Context on contig NC_007795 from base 130862 to 142398 (11537 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
138 130862 132067 1206 +       1: 1 ff
isu
Capsular polysaccharide synthesis enzyme Cap5L cds.138, GeneID:3919834, LocusTag:SAOUHSC_00125, YP_498725.1, gi|88193938
139 132078 132635 558 + 10     1: 1 ff
isu
Capsular polysaccharide synthesis enzyme CapM cds.139, GeneID:3919835, LocusTag:SAOUHSC_00126, YP_498726.1, gi|88193939
140 132635 133522 888 + -1     1: 1 ff
isu
UDP-glucose 4-epimerase (EC 5.1.3.2) cds.140, GeneID:3919836, LocusTag:SAOUHSC_00127, YP_498727.1, gi|88193940
141 133576 134838 1263 + 53     1: 1 ff
isu
Capsular polysaccharide synthesis enzyme Cap8O cds.141, GeneID:3919837, LocusTag:SAOUHSC_00128, YP_498728.1, gi|88193941
142 134915 136060 1146 + 76     1: 1 ff
isu
Capsular polysaccharide synthesis enzyme Cap8P cds.142, GeneID:3919838, LocusTag:SAOUHSC_00129, YP_498729.1, gi|88193942
143 136451 136125 327 - 64     3: 4 3 2 ff
ilit(
14570922)
ilit(15520015)
isu
dlit(14570922)
dlit(15520015)
Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI cds.143, GeneID:3919839, LocusTag:SAOUHSC_00130, YP_498730.1, gi|88193943
144 136841 136458 384 - 6     3: 4 3 2 ff
isu
Inner membrane protein YbaN cds.144, GeneID:3919840, LocusTag:SAOUHSC_00131, YP_498731.1, gi|88193944
145 137268 138755 1488 + 426     2: 7 9 ff
isu
Aldehyde dehydrogenase B (EC 1.2.1.22) cds.145, GeneID:3919841, LocusTag:SAOUHSC_00132, YP_498732.1, gi|88193945
146 139401 140360 960 + 645     4: 6 5 10 8 ff
idu(2)
idu(2)
Cobalt-zinc-cadmium resistance protein cds.146, GeneID:3919842, LocusTag:SAOUHSC_00133, YP_498733.1, gi|88193946
147 140625 140422 204 - 61       ff FIG01108246: hypothetical protein cds.147, GeneID:3919843, LocusTag:SAOUHSC_00134, YP_498734.1, gi|88193947
148 140804 141316 513 + 178       ff FIG01108032: hypothetical protein cds.148, GeneID:3919844, LocusTag:SAOUHSC_00135, YP_498735.1, gi|88193948
149 141658 142398 741 + 341       ff ABC transporter ATP-binding subunit cds.149, GeneID:3919845, LocusTag:SAOUHSC_00136, YP_498736.1, gi|88193949

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Heme,_hemin_uptake_and_utilization_systems_in_GramPositives SvetaG FIG039061: hypothetical protein related to heme utilization
Hypothetical_DUF454 SvetaG FIG039061: hypothetical protein related to heme utilization
FIG039061:_hypothetical_protein_related_to_heme_utilization SvetaG FIG039061: hypothetical protein related to heme utilization


  Protein Sequence

>fig|93061.3.peg.144 Inner membrane protein YbaN
MRLILIVIGLIFTALGIAGAVLPLLPTTPFLLVAVFCFARSSDRFYNWLINQKIYKEYVE
NFYLHRGYTLQQKIKILISLYIVIGFSIYMVDVLAVRVGLIIMVIIQTAVLFTFVKTLPK
SNHKIEE

MD5 = 3ebc886ff3845aed712ee80666c15d65


  DNA Sequence

>fig|93061.3.peg.144 Inner membrane protein YbaN
atgcgacttattttaatcgtcattggcttaatatttacagcgcttggtattgcaggtgcc
gtattacctttactgccaacgaccccttttttactcgtagcagttttttgctttgctcga
agttcagatcgcttttacaattggcttattaatcaaaaaatttataaagaatatgtagaa
aacttttatttacatcgaggctacacgctacaacagaaaattaaaattttaattagctta
tacattgtaataggtttttcaatttatatggtggatgttcttgcagtccgtgtaggatta
atcataatggttatcatacaaaccgctgtactctttacatttgtaaaaacattacccaaa
tcaaatcataaaatagaggagtga


  DNA with Flanking Sequence

>fig|93061.3.peg.144 Inner membrane protein YbaN
ctacctttaacaaattccccattgataaataaaccataattctctgcaatataatctcga
acgtttactgccatattatctctcctttgtttattggctataatataaatctcttagcat
catatttaataatgcttttaaacgatatgattcacattatatagtaagcgtttacatttt
ataaaataatcagctcacagaagtctcatttttaaaacttttgcgtcgtttttgcacata
aaaataatcttattttcgaaaacatattgcacttttcaaaaataaaacacataatataac
tataatacttgagaataattctcattaaatagtttggttgttatgaaagtcgcgcttaaa
atgcgttaatgtgacaaggataattcaacatcgtttcattttactgagtcattgcactta
tcatacacattatatttagcatgagttatattactaaaacaatattacatgcgcattagt
actagaatggagttttttcaatgcgacttattttaatcgtcattggcttaatatttacag
cgcttggtattgcaggtgccgtattacctttactgccaacgaccccttttttactcgtag
cagttttttgctttgctcgaagttcagatcgcttttacaattggcttattaatcaaaaaa
tttataaagaatatgtagaaaacttttatttacatcgaggctacacgctacaacagaaaa
ttaaaattttaattagcttatacattgtaataggtttttcaatttatatggtggatgttc
ttgcagtccgtgtaggattaatcataatggttatcatacaaaccgctgtactctttacat
ttgtaaaaacattacccaaatcaaatcataaaatagaggagtgattgcccatgtttatgg
cagaaaatagattacaattacaaaaaggcagtgcggaagaaacgattgaacgtttttaca
atagacaaggtattgaaactattgaaggcttccaacaaatgtttgtcactaaaacattaa
ataccgaggatacagacgaagttaaaatcttaactatttgggaatctgaagatagcttta
ataattggttgaattccgatgtatttaaagaagctcataaaaatgtacgtttaaaaagtg
atgacgatggacagcaaagtccaatattatcaaataaagtattcaaatatgatattggct
accactatcaaaaataaatatattaaaaacccctagtcaccgctggttgtctaaaccaac
ttcatgattaggggttttttattatttgtgacgtaaaggtacgaattcatccggcttgtc
tgtgcgcaatccaaaataatattctattgcttcacaaatacgtcgtgatgcttgtccatc
acca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA0170 Staphylococcus aureus N315     Unknown
cmr|NT02SA0163 Staphylococcus aureus Mu50     Protein of unknown function (DUF454) family
cmr|NT05SA0118 Staphylococcus aureus NCTC 8325     protein of unknown function
cmr|SACOL0153 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_0169 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB41381.1 Staphylococcus aureus subsp. aureus N315     conserved hypothetical protein
dbj|BAB56328.1 Staphylococcus aureus subsp. aureus Mu50     conserved hypothetical protein
dbj|BAF66384.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF77048.1 Staphylococcus aureus subsp. aureus Mu3     conserved hypothetical protein
fig|158878.1.peg.166 Staphylococcus aureus subsp. aureus Mu50 FIG   Inner membrane protein YbaN
fig|158878.14.peg.164 Staphylococcus aureus subsp. aureus Mu50 FIG   Inner membrane protein YbaN
fig|158879.1.peg.164 Staphylococcus aureus subsp. aureus N315 FIG   Inner membrane protein YbaN
fig|158879.11.peg.166 Staphylococcus aureus subsp. aureus N315 FIG   Inner membrane protein YbaN
fig|359786.13.peg.192 Staphylococcus aureus subsp. aureus JH9 FIG   Inner membrane protein YbaN
fig|359786.3.peg.1127 Staphylococcus aureus subsp. aureus JH9 FIG   Inner membrane protein YbaN
fig|359787.3.peg.2036 Staphylococcus aureus subsp. aureus JH1 FIG   Inner membrane protein YbaN
fig|367830.3.peg.1459 Staphylococcus aureus subsp. aureus USA300 FIG   Inner membrane protein YbaN
fig|426430.8.peg.121 Staphylococcus aureus subsp. aureus str. Newman FIG   Inner membrane protein YbaN
fig|451515.3.peg.228 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Inner membrane protein YbaN
fig|451516.9.peg.217 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Inner membrane protein YbaN
fig|455227.3.peg.182 Staphylococcus aureus D30 FIG   Inner membrane protein YbaN
fig|505321.3.peg.1835 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Inner membrane protein YbaN
fig|553565.3.peg.2484 Staphylococcus aureus A5937 FIG   Inner membrane protein YbaN
fig|553567.3.peg.1093 Staphylococcus aureus A5948 FIG   Inner membrane protein YbaN
fig|553568.3.peg.799 Staphylococcus aureus A6224 FIG   Inner membrane protein YbaN
fig|553571.3.peg.2069 Staphylococcus aureus A6300 FIG   Inner membrane protein YbaN
fig|553573.3.peg.1960 Staphylococcus aureus A8115 FIG   Inner membrane protein YbaN
fig|553574.3.peg.1725 Staphylococcus aureus A8117 FIG   Inner membrane protein YbaN
fig|553577.3.peg.840 Staphylococcus aureus A8796 FIG   Inner membrane protein YbaN
fig|553580.3.peg.576 Staphylococcus aureus A8819 FIG   Inner membrane protein YbaN
fig|553581.3.peg.2091 Staphylococcus aureus A9299 FIG   Inner membrane protein YbaN
fig|553588.3.peg.1477 Staphylococcus aureus A9719 FIG   Inner membrane protein YbaN
fig|553590.4.peg.1171 Staphylococcus aureus A9754 FIG   Inner membrane protein YbaN
fig|553592.3.peg.854 Staphylococcus aureus A9763 FIG   Inner membrane protein YbaN
fig|553594.3.peg.830 Staphylococcus aureus A9765 FIG   Inner membrane protein YbaN
fig|553601.3.peg.29 Staphylococcus aureus A10102 FIG   Inner membrane protein YbaN
fig|585891.3.peg.164 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Inner membrane protein YbaN
fig|644279.4.peg.238 Staphylococcus aureus subsp. aureus 132 FIG   Inner membrane protein YbaN
fig|680649.3.peg.1638 Staphylococcus aureus subsp. aureus MR1 FIG   Inner membrane protein YbaN
fig|681288.4.peg.133 Staphylococcus aureus subsp. aureus ED98 FIG   Inner membrane protein YbaN
fig|703339.3.peg.167 Staphylococcus aureus 04-02981 FIG   Inner membrane protein YbaN
fig|93061.5.peg.123 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Inner membrane protein YbaN
fig|93062.4.peg.620 Staphylococcus aureus subsp. aureus COL FIG   Inner membrane protein YbaN
gb|AAW37450.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD22737.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD29312.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ47959.1 Staphylococcus aureus subsp. aureus JH9     protein of unknown function DUF454
gb|ABR51019.1 Staphylococcus aureus subsp. aureus JH1     protein of unknown function DUF454
gb|ABX28212.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical membrane protein
gb|EEV26331.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV65041.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV67009.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV71785.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV74355.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV76993.1 Staphylococcus aureus A6300     conserved hypothetical protein
gb|EEV81004.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV83474.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEV84703.1 Staphylococcus aureus A5937     conserved hypothetical protein
gb|EEW48125.1 Staphylococcus aureus D30     hypothetical protein SAD30_1680
gi|13700082 Staphylococcus aureus subsp. aureus N315 NCBI   conserved hypothetical protein
gi|14245933 Staphylococcus aureus subsp. aureus Mu50 NCBI   conserved hypothetical protein
gi|147739661 Staphylococcus aureus subsp. aureus JH9 NCBI   protein of unknown function DUF454
gi|148266592 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0152
gi|149945083 Staphylococcus aureus subsp. aureus JH1 NCBI   protein of unknown function DUF454
gi|150373124 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150392631 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_0157
gi|151220324 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0112
gi|156720631 Staphylococcus aureus subsp. aureus Mu3 NCBI   conserved hypothetical protein
gi|156978496 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0165
gi|15923156 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV0166
gi|15925870 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0161
gi|160367241 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical membrane protein
gi|161508432 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0180
gi|253316302 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_09211
gi|255004963 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_00800
gi|257787991 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257794019 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257840582 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257842587 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257847789 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257850407 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257854040 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|257858116 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257860652 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|257861930 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258408573 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258421163 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258438913 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258444148 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258447027 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|258448485 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258451604 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258455718 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|259163569 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1680
gi|57285356 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57651170 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0153
gi|87128223 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87162249 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0169
gi|87201502 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88193944 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00131
img|637091761 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637098665 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637150936 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637886824 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637892805 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639108488 Staphylococcus aureus aureus JH1 IMG   Protein of unknown function DUF454
img|640564482 Staphylococcus aureus aureus JH9 IMG   protein of unknown function DUF454
img|640778227 Staphylococcus aureus aureus JH1 IMG   protein of unknown function DUF454
img|640794472 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640902887 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641308140 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical membrane protein
img|641771886 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical membrane protein
kegg|saa:SAUSA300_0169 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL0153 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0112 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sah:SaurJH1_0157 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_0152 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sao:SAOUHSC_00131 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sau:SA0161   KEGG   hypothetical protein
kegg|sav:SAV0166   KEGG   hypothetical protein
kegg|saw:SAHV_0165 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_0180 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_370690.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV0166
ref|NP_373403.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0161
ref|YP_001245535.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_0152
ref|YP_001315306.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_0157
ref|YP_001331147.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0112
ref|YP_001440755.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0165
ref|YP_001574091.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_0180
ref|YP_185053.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0153
ref|YP_492883.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0169
ref|YP_498731.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00131
ref|ZP_04839515.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_09211
ref|ZP_05143564.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_00800
ref|ZP_05642998.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05680858.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05684090.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05690004.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05692482.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05695177.1 Staphylococcus aureus A6300 RefSeq   conserved hypothetical protein
ref|ZP_05696598.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05699630.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
ref|ZP_05703673.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A5IP36 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein precursor
tr|A6QDF2 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A6TXV1 Staphylococcus aureus (strain JH1) TrEMBL   Putative uncharacterized protein precursor
tr|A7WXE6 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8YZ89 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Hypothetical membrane protein
tr|Q2FK95 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2G1J1 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HJK4 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q7A826 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA0161
tr|Q99X55 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CDD::32660 972.600;1-121
evidence_code ff
evidence_code isu;Heme,_hemin_uptake_and_utilization_systems_in_GramPositives
isoelectric_point 10.00
molecular_weight 14570
PFAM::PF04304 963.500;42-118
Phobius::signal 1-19
Phobius::transmembrane 29-46,74-91,97-115
PSORT::CytoplasmicMembrane 9.99
PSORT_score::CytoplasmicMembrane 9.99
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search