The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|93061.3.peg.1068: Staphylococcus aureus subsp. aureus NCTC 8325

This feature in The SEED Viewer

NCBI Taxonomy Id: 93061

Current Assignment: FIG01108361: hypothetical protein
Translate Function Assignments



Context on contig NC_007795 from base 1068965 to 1080365 (11401 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1060 1068965 1069552 588 +       12: 4 8 9 6 11 15 12 13 5 7 2 3 ff
ilit(
1624460)
ilit(17090528)
isu
isu
isu
Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15) cds.1060, GeneID:3920749, LocusTag:SAOUHSC_01107, YP_499651.1, gi|88194853
1061 1069545 1070048 504 + -8     3: 10 2 3 ff
isu
FIG009886: phosphoesterase cds.1061, GeneID:3920750, LocusTag:SAOUHSC_01108, YP_499652.1, gi|88194854
1062 1070176 1070343 168 + 127       ff FIG01107850: hypothetical protein cds.1062, GeneID:3920751, LocusTag:SAOUHSC_01109, YP_499653.1, gi|88194855
1063 1070537 1070866 330 + 193     1: 1 ff
isu
Hypothetical protein, similarity with fibrinogen-binding protein Efb cds.1063, GeneID:3920752, LocusTag:SAOUHSC_01110, YP_499654.1, gi|88194856
1064 1071275 1071183 93 - 316         hypothetical protein cds.1064, GeneID:3920753, LocusTag:SAOUHSC_01111, YP_499655.1, gi|88194857
1065 1071636 1071235 402 - -41       ff FIG017917: hypothetical protein cds.1065, GeneID:3920754, LocusTag:SAOUHSC_01112, YP_499656.1, gi|88194858
1066 1072308 1072814 507 + 671       ff hypothetical protein cds.1066, GeneID:3920755, LocusTag:SAOUHSC_01113, YP_499657.1, gi|88194859
1072 1073073 1073570 498 + 258     1: 1 ff
ilit(
12089659)
ilit(17351618)
ilit(7934883)
isu
Extracellular fibrinogen-binding protein Efb cds.1072, GeneID:3920717, LocusTag:SAOUHSC_01114, YP_499658.1, gi|88194860
1067 1073724 1074074 351 + 153       ff Involved in expression of fibrinogen binding protein cds.1067, GeneID:3920718, LocusTag:SAOUHSC_01115, YP_499659.1, gi|88194861
1068 1074500 1074745 246 + 425       ff FIG01108361: hypothetical protein cds.1068, GeneID:3920719, LocusTag:SAOUHSC_01118, YP_499660.1, gi|88194862
1073 1074797 1074952 156 + 51         hypothetical protein cds.1073, GeneID:3921685, LocusTag:SAOUHSC_A01079, YP_499661.1, gi|88196683
1074 1075081 1074896 186 - -57       ff FIG01107916: hypothetical protein cds.1074, GeneID:3920720, LocusTag:SAOUHSC_01119, YP_499662.1, gi|88194863
1075 1075509 1075291 219 - 209       ff FIG01108338: hypothetical protein cds.1075, GeneID:3921686, LocusTag:SAOUHSC_A01081, YP_499663.1, gi|88196684
1076 1075936 1075703 234 - 193       ff FIG01108519: hypothetical protein cds.1076, GeneID:3920721, LocusTag:SAOUHSC_01120, YP_499664.1, gi|88194864
1077 1077372 1076413 960 - 476     1: 14 ff
isu
Alpha-hemolysin precursor cds.1077, GeneID:3920722, LocusTag:SAOUHSC_01121, YP_499665.1, gi|88194865
opr.41 1077688 1077663 26 - 290         The putative SarA binding motif for hla gene RTB_5249824
opr.34 1077833 1077584 250 - -105         SarA protected fragment upstream of hla gene RTB_5249774
opr.37 1077773 1077674 100 - -160         SarA retarted fragment upstream of hla gene RTB_5249800
1078 1078045 1078191 147 + 271       ff Doubtful CDS. No database matches cds.1078, GeneID:3920723, LocusTag:SAOUHSC_01122, YP_499666.1, gi|88194866
1079 1078148 1078372 225 + -44       ff FIG01108126: hypothetical protein cds.1079, GeneID:3920724, LocusTag:SAOUHSC_01123, YP_499667.1, gi|88194867
1080 1079532 1078816 717 - 443       ff FIG01107944: hypothetical protein cds.1080, GeneID:3920725, LocusTag:SAOUHSC_01124, YP_499668.1, gi|88194868
1081 1080365 1079640 726 - 107       ff FIG01107880: hypothetical protein cds.1081, GeneID:3920726, LocusTag:SAOUHSC_01125, YP_499669.1, gi|88194869

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|93061.3.peg.1068 FIG01108361: hypothetical protein
MGWGPTQKLAKSQHTKMCKLAGPQQREIGSPIPTNNASWRGPQHRSWRKVSLQKCASWRG
PNIEKLEPQFLQTMQVGVGHR

MD5 = 474f9da9dc8b4b43d42810fc39016b1f


  DNA Sequence

>fig|93061.3.peg.1068 FIG01108361: hypothetical protein
ttggggtggggcccaacacagaagctggcgaaaagtcagcatacaaaaatgtgcaagttg
gcggggccacaacagagagaaataggatcaccaattccaacaaacaatgcaagttggcgg
gggccccaacatagaagctggcgaaaagtcagcttacaaaaatgtgcaagttggcggggc
cccaacatagagaaattggaaccccaatttctacagacaatgcaagttggggtaggacat
cgataa


  DNA with Flanking Sequence

>fig|93061.3.peg.1068 FIG01108361: hypothetical protein
ttcgtatcaatggctgatgctaaagttgcattagaaaaaatatacaaagaaattgatgaa
attataaatagataataaataaaacaggttgagacaaaaaatggtcttaacctgttttca
atttgcatatgtgataaattctatatcaaaatgcttatgtataatgaatgacatttaaaa
gtaggggagacaaatataaatacaatagttcctaggattactctcaaaataactatatca
attatttactttgctctcctattttttaaaatatgtacatgtttaaacaatcaaaagtgt
acaatattaaattatcatttccagttctagtgctatattggtagtagttgactaaatgaa
aataagcttataacaagttttttcaatactcgtggggccacaacagagagaaataggatc
accaattccaacagacaatgcaagttggcggggccccaacatagagaaattggatcacca
atttcaacagacaatgcaagttggggtggggcccaacacagaagctggcgaaaagtcagc
atacaaaaatgtgcaagttggcggggccacaacagagagaaataggatcaccaattccaa
caaacaatgcaagttggcgggggccccaacatagaagctggcgaaaagtcagcttacaaa
aatgtgcaagttggcggggccccaacatagagaaattggaaccccaatttctacagacaa
tgcaagttggggtaggacatcgataaagaaatactttttctttagcaattagtatttctt
atgcatgagctttactcatgtattcattttttaagtacacattagctacagctaatgata
aagaaccactacataataaatcattagtggttctttatcatttctatctcactcttttac
tggaagaaaaagtttacgtttgtagaacatgccacaataccaaaaataattaagaaaaat
aagacgataagcatgatgacacttttcaaacaacctctatcagtttctttcgattttctt
tgttgaacctttttataatcttcaagtagttttgcggcttttttatttatatgtttattc
atgatgttgactccttataatatatgtttaattcattaaaatagttgaaaacatgacttg
aaataaagatataaagctaaagtaaggatgttcaattgtttcaaattttatgaaagtata
acgttaaatatgttaatttgatgatgatatttgctttttattttcc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|SACOL1170 Staphylococcus aureus subsp. aureus COL     hypothetical protein
fig|93062.4.peg.1537 Staphylococcus aureus subsp. aureus COL FIG   FIG01108361: hypothetical protein
gb|AAW36549.1 Staphylococcus aureus subsp. aureus COL     hypothetical protein SACOL1170
gb|ABD30230.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gi|57284455 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL1170
gi|57650269 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL1170
gi|87202420 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194862 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01118
img|637151932 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637893753 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
kegg|sac:SACOL1170 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sao:SAOUHSC_01118 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
ref|YP_186033.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL1170
ref|YP_499660.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01118
tr|Q2FZB6 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HGS4 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code ff
isoelectric_point 11.69
molecular_weight 9189
PSORT::unknown unknown
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search